KEGG   Nakamurella multipartita: Namu_0673Help
Entry
Namu_0673         CDS       T00991                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nml  Nakamurella multipartita
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nml00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Namu_0673
DNA repair and recombination proteins [BR:nml03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Namu_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
741114..741722
Genome map
AA seq 202 aa AA seqDB search
MAVYEGPVQDLIDELGRLPGIGPKSAQRIAFHLLTADPVDITRLQSALQRVKDEVRFCTV
CGNVAADEKCRICADPAREDAVICVVEEPKDVAAVERTREFRGKYHVLGGAISPIDGIGP
DQLRIAPLLTRIAAPGVREVILATDPNLEGEATATYLTRLLQPFPGLTVTRLASGLPVGG
DLEYADEVTLGRAFAGRRSVDA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtctacgagggtcccgtccaggacctgatcgacgagctggggcggctgccgggc
atcgggcccaagtcggcccagcggatcgcgttccacctgctcaccgccgacccggtcgac
atcacccggctgcagagcgccctgcaacgggtcaaggacgaggtccggttctgcaccgtc
tgcgggaacgtggccgccgacgagaagtgccgcatctgcgccgatccggcccgggaggac
gcggtgatctgcgtcgtcgaggaacccaaggacgtcgccgcggtcgagcggacccgtgag
ttccgcggcaagtaccacgtgctcggcggggccatctcgccgatcgacggcatcggcccg
gaccagctgcggatcgccccgttgctcacccggatcgccgcgcccggcgtccgggaggtc
atcctggccaccgatcccaacctggaaggggaggcgaccgccacctacctgacccggttg
ttgcagccgttccccggtttgaccgtcacccggctggccagcgggctgccggtgggtggc
gacctggagtacgccgacgaggtcaccctcggtcgggcgttcgccggtcgacgttcggtc
gatgcctga

DBGET integrated database retrieval system