KEGG   Nakamurella multipartita: Namu_0673Help
Entry
Namu_0673         CDS       T00991                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nml  Nakamurella multipartita
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nml03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
741114..741722
Genome map
AA seq 202 aa AA seqDB search
MAVYEGPVQDLIDELGRLPGIGPKSAQRIAFHLLTADPVDITRLQSALQRVKDEVRFCTV
CGNVAADEKCRICADPAREDAVICVVEEPKDVAAVERTREFRGKYHVLGGAISPIDGIGP
DQLRIAPLLTRIAAPGVREVILATDPNLEGEATATYLTRLLQPFPGLTVTRLASGLPVGG
DLEYADEVTLGRAFAGRRSVDA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtctacgagggtcccgtccaggacctgatcgacgagctggggcggctgccgggc
atcgggcccaagtcggcccagcggatcgcgttccacctgctcaccgccgacccggtcgac
atcacccggctgcagagcgccctgcaacgggtcaaggacgaggtccggttctgcaccgtc
tgcgggaacgtggccgccgacgagaagtgccgcatctgcgccgatccggcccgggaggac
gcggtgatctgcgtcgtcgaggaacccaaggacgtcgccgcggtcgagcggacccgtgag
ttccgcggcaagtaccacgtgctcggcggggccatctcgccgatcgacggcatcggcccg
gaccagctgcggatcgccccgttgctcacccggatcgccgcgcccggcgtccgggaggtc
atcctggccaccgatcccaacctggaaggggaggcgaccgccacctacctgacccggttg
ttgcagccgttccccggtttgaccgtcacccggctggccagcgggctgccggtgggtggc
gacctggagtacgccgacgaggtcaccctcggtcgggcgttcgccggtcgacgttcggtc
gatgcctga

DBGET integrated database retrieval system