KEGG   Nakamurella multipartita: Namu_0701Help
Entry
Namu_0701         CDS       T00991                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nml  Nakamurella multipartita
Pathway
nml00010  Glycolysis / Gluconeogenesis
nml00620  Pyruvate metabolism
nml00640  Propanoate metabolism
nml00680  Methane metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_0701
   00620 Pyruvate metabolism
    Namu_0701
   00640 Propanoate metabolism
    Namu_0701
  Energy metabolism
   00680 Methane metabolism
    Namu_0701
Enzymes [BR:nml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Namu_0701
Lipid biosynthesis proteins [BR:nml01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Namu_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACV77115
UniProt: C8X8D9
Position
770762..772492
Genome map
AA seq 576 aa AA seqDB search
MSAVPTPATDQLRAARDLLLQYRDDRDQAVERFRWPRPTTFNWGVEWFDVIATEHPDRPA
LVIVEPDGSVGSWTYGQLARRTDQVAGWLRANGVQRGDRIVLMLGNQVELWEIVLAAIKI
GAVIIPASTLLTPDDLADRVGRGGARFVVARDVDTDGFRHVPGVFVRIAVGRPVDGWIEY
EDSAAYPDEGFVPEGVSRAGDPLLLYFTSGTTALPKLVEHTQISYPIGHLSTMYWIGLRP
GDVHLNISSPGWAKHAWSCVFAPWLAQATVLVFNYARFDAVELMRVLDEQRVNTFCAPPT
VWRMLIQADLSRLTTPPRELVGAGEPLNPEVIEQVQRAWGVTIRDGFGQTEMTLAVGNAP
GQPVRPGSMGRPMPGYRVELLDPSTGAPGEEGELCVDLSAGTVGLLAGYHGEPKRTAEAT
RGGYYHTGDLASRDADGYLTYVGRDDDVFKASDYRISPFAVESVLLEHPAVAEAAVVPSP
DPLRLAVPKAYVVLAEGYHPNKVAARLIFEHSRDRLAPYQRIRRLEFGPLPKTISGKIRR
VELRGQEQQRHGAGGAGQSAAEAGIEYRVEDFPELR
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgtgccgactcccgcgaccgaccagctccgggccgcgcgcgatctgctgctg
cagtaccgggacgaccgcgaccaggccgtcgaacgctttcgctggccccgacccaccacg
ttcaactggggcgtcgagtggttcgacgtgatcgccacggagcacccggaccggcccgcg
ctggtcatcgtcgaaccggacggttcggtgggctcctggacctatggtcagctcgcccgg
cgtacggatcaggtggccggctggctgcgggccaacggggtgcagcgcggcgaccggatc
gtgctgatgctgggcaaccaggtcgagctgtgggagatcgtgctggccgcgatcaagatc
ggcgcggtcatcatcccggccagcaccctgctcaccccggacgatctggccgaccgggtg
ggccgcggcggtgcccggttcgtggttgcccgggacgtggacaccgacgggttccggcac
gtgcccggcgtcttcgtgcggatcgccgtcggccgcccggtcgacgggtggatcgagtac
gaggacagcgccgcctaccccgacgagggtttcgtgcccgagggagtctcccgggccggc
gacccgctgctgctctacttcacctcgggcaccaccgcgctgcccaaactggtcgagcac
acccagatctcctacccgatcgggcatctgagcacgatgtactggatcggcctgcggccc
ggcgacgtgcacctgaacatctcctcgcccgggtgggccaagcacgcctggtcctgcgtg
ttcgcgccctggctggctcaggcgacggtgctcgtcttcaactacgcccggttcgacgcg
gtcgagctgatgcgggtgctcgacgagcagcgggtgaacaccttctgcgcaccgccgacc
gtgtggcggatgctgatccaggccgacctgagccgcctgaccacgccgccgcgggagctg
gtcggggccggggaaccgctcaatcccgaggtgatcgagcaggtccagcgggcctgggga
gtgaccatccgggacggcttcgggcagacggagatgaccctcgcggtcggcaacgcgccg
ggtcagccggtgcgcccgggctcgatgggtcggccgatgcccggctaccgggtggagctg
ctggatcccagcaccggagcgccgggggaggagggcgagctgtgcgtcgacctgtccgcc
gggaccgtggggctgctcgccgggtatcacggcgagccgaagcggaccgccgaagccacc
cggggcggctactaccacaccggtgacctggcctcccgggatgcggacgggtacctgacc
tacgtcggccgggacgacgacgtattcaaggcgtcggattaccggatctcgccgttcgcc
gtcgaatcggtgctgttggagcacccggcggtggccgaagcggcggtggtgccctcgccg
gatccactgcgactggccgtgcccaaggcctacgtcgtgctggccgagggctaccacccg
aacaaggtcgccgcgcggctgatcttcgagcactcccgggaccggctcgctccctaccag
cggatccggcggctggagttcgggccgctgcccaagaccatctccggcaagatccgccgg
gtcgaactgcgcgggcaggagcagcagcggcacggcgccggcggcgccggtcagtccgcg
gccgaagccggcatcgagtaccgcgtggaggacttccccgaactgcgttga

DBGET integrated database retrieval system