KEGG   Nakamurella multipartita: Namu_0803Help
Entry
Namu_0803         CDS       T00991                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nml  Nakamurella multipartita
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Namu_0803
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Namu_0803
   00650 Butanoate metabolism
    Namu_0803
  Lipid metabolism
   00071 Fatty acid degradation
    Namu_0803
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Namu_0803
   00310 Lysine degradation
    Namu_0803
   00360 Phenylalanine metabolism
    Namu_0803
   00380 Tryptophan metabolism
    Namu_0803
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Namu_0803
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Namu_0803
   00281 Geraniol degradation
    Namu_0803
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Namu_0803
   00627 Aminobenzoate degradation
    Namu_0803
   00930 Caprolactam degradation
    Namu_0803
Enzymes [BR:nml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Namu_0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
885272..886327
Genome map
AA seq 351 aa AA seqDB search
MRHRDGSAIQYLCTDYRGAMNQTEESLVIRVEGRLGRIMLNRPRQINALTLPMIDGIRAA
LAGWADDPAVDVVLIDGAGERGLCAGADIRALRQSILDGSDEAMTFLADEYVMNKALADY
PKPIVADQRGITFGGGLGVSAHCSVRIVAEDSQLAMPETLIGLWPDVGILHLLGRSPGQL
GVHAALIGARLDAGDAIRAGLADHFVPADARPALLDALRAGVVPEFAGPPPAGALQQASW
IDECYAFATAEEILSALLAHPDPAAQAAGQALAGMAPLSVKVTLRAVRAAASMTLAQVLA
QDLRFAAHFMARPDLPEGIPAQVVDKDRNPRWQPARLADVSDADVDAFFTG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaccgtgacgggagtgcaatccagtacctgtgcactgattaccgtggcgcgatg
aatcaaaccgaagagtccctggtgatccgggtcgagggccgattgggccggatcatgctg
aaccggccgcggcagatcaacgcgctgacgctgccgatgatcgacggcatccgcgccgcg
ttggccggctgggccgacgaccccgcggtcgacgtcgtgttgatcgacggggcgggcgag
cggggtctgtgcgccggcgccgacatccgggcgctgcggcagtcgattctggacggctcc
gacgaggccatgaccttcctggccgacgagtacgtcatgaacaaggcgctggccgactac
cccaagccgatcgtggccgaccagcgcggcatcaccttcggtggcgggctgggggtctcc
gcgcactgctcggtgcgcatcgtcgcggaggattcgcagctggccatgcccgagacgctg
atcgggctgtggcccgacgtcggcatcctgcacctgctcggccgctcgcccggccagctc
ggggtgcacgccgcgttgatcggggcccggctggacgccggcgacgcgatccgggccggg
ctggccgaccacttcgtgccggctgacgcgcgaccggcgctgctggacgcgctgcgcgcc
ggggtggtccccgagttcgccgggccgccgccggccggggcgctgcagcaggcgagctgg
atcgacgagtgttacgcgttcgccacggccgaggagatcctgagcgccctgctggcccat
ccggacccggccgcgcaggcggccggccaggcgctggccgggatggcgccgctgtcggtc
aaggtgacgctgcgcgcggtccgggcggcggcctcgatgaccctggcgcaggtgctcgcc
caggacctgcggttcgccgcccacttcatggcccggccggacctgcccgaggggatcccc
gcgcaggtggtggacaaggatcgcaacccgcgctggcaaccggcccgcctcgccgacgtc
tccgacgccgacgtggacgccttcttcaccggctga

DBGET integrated database retrieval system