KEGG   Nakamurella multipartita: Namu_0820Help
Entry
Namu_0820         CDS       T00991                                 

Definition
methionine-R-sulfoxide reductase (EC:1.8.4.12)
Orthology
K07305  
peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
nml  Nakamurella multipartita
Brite
Enzymes [BR:nml01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.12  peptide-methionine (R)-S-oxide reductase
     Namu_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(910122..910556)
Genome map
AA seq 144 aa AA seqDB search
MTINPMKSDKTYDVTKSDDQWRAELSPQEYQVLRQAGTERPFSSPYETDETVGVYRCRGC
GSELFRSEHKFDAHCGWPAFYTPLAADRVELIEDRSMFTTRTEVRCATCGSHLGHVFSGE
GYPTPTNDRYCINGVSLTLEPVDG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcaaccccatgaagtccgacaagacctacgacgtcaccaagtccgacgatcag
tggcgggccgagctcagcccgcaggagtaccaggtgctgcgccaggcgggcaccgagcgg
ccgttctccagcccgtacgagaccgacgagacggtcggcgtgtaccgctgtcgcggttgc
ggcagcgagctgttccgcagcgagcacaagttcgacgcgcactgcggctggccggccttc
tacaccccgctggccgcggaccgggtcgagctgatcgaggaccgctcgatgttcacgacc
cgcaccgaggtgcgctgcgcgacctgcggctcccacctgggccacgtcttcagcggcgag
ggctacccgaccccgaccaacgaccgctactgcatcaacggggtgtcgctgaccctcgag
ccggtcgacggctga

DBGET integrated database retrieval system