KEGG   Nakamurella multipartita: Namu_0850Help
Entry
Namu_0850         CDS       T00991                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nml  Nakamurella multipartita
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nml00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
939445..940401
Genome map
AA seq 318 aa AA seqDB search
MNRSPASGRPLERAVIMGVVNVTADSFSDGGRYLAAPAAVERGLALVAAGADLVDVGGES
TRPGAHRVAAEVEAARVVPVVGALAAQGVRCSVDTTRAEVAAAAVAAGARIVNDVSGGLA
DPEMAAAVADAGVAWILMHWRGHSASMDDLAVYDDVVDDVRRELSARVEAALAAGVREDA
IVLDPGLGFAKTAEHNWALLRALPSITGLDGPGWGLPVLVGASRKRFLGALLADAAGPRP
PAGREAATTVISGLAAAAGAWGVRVHEAADSLDAVRVAAAVTGRGPVRRLDPERLCHHSP
GYDAPADPVTGGADRGSE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgatcgcccgccagcggccggccgctggagcgcgcggtgatcatgggcgtggtc
aacgtgaccgcggattcgttctccgacggtggccgctacctggccgccccggccgcggtc
gagcggggcctggccttggtcgcggccggcgccgacctggtcgacgtcggcggcgagtcg
acccgccccggggcccaccgggtggcggccgaggtcgaggccgcgcgggtcgtcccggtg
gtcggcgcgttggccgcccagggcgtgcggtgcagcgtcgacaccacccgggccgaggtc
gccgcagccgccgttgccgcgggcgcgcggatcgtcaacgacgtctccggcggcctggcc
gacccggagatggcggcggcggtcgccgacgccggggtcgcctggatcctgatgcactgg
cgcggccacagtgcctccatggacgacctggccgtctacgacgacgtcgtcgacgacgtc
cggcgggagctgagcgcccgggtggaggccgccctggccgccggggtccgcgaggacgcg
atcgtgctggacccgggtctgggctttgccaagacggccgagcacaactgggccctgctg
cgggcgctgccgtcgatcacgggtctggacgggcccggctggggcctgcccgtgctggtc
ggcgcctcccgcaaacggttcctgggcgccctgctggccgacgccgccggaccgcggccg
ccggccgggcgggaggcggcaacgaccgtgatctccgggctggccgccgcggccggcgcc
tggggagtgcgggtgcatgaggccgccgactccctggacgcggtgcgggtggcggccgcg
gtcaccggacgcgggccggttcgccggctggaccccgagcggctgtgtcatcattcgccg
ggctatgatgcgcccgccgacccggtcacgggcggtgccgaccgggggagcgaataa

DBGET integrated database retrieval system