KEGG   Nakamurella multipartita: Namu_0889Help
Entry
Namu_0889         CDS       T00991                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
nml  Nakamurella multipartita
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_0889
Enzymes [BR:nml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Namu_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(979516..980958)
Genome map
AA seq 480 aa AA seqDB search
MTSISAPTQFPPGFLWGGATAANQVEGGYDQGGKGLSIQDVMPQGIVGPRTDGPTPENLK
LTGIDFYHRYAEDIALFAEMGFSVYRFSIAWSRIFPGGDDAEPNEEGLAFYDRVLDELER
HGIEPLITLSHYETPLAIAEKYDGWVSRDVIALFERYVRVVFARYGHRVKYWLTFNEINS
VIHAPFMSGGINTPKDELTPTDLYQAIHHELVASALATKIAHETDPQIKVGCMVLGMPIY
PLSPDPNDLLASMTADHANLMFSDVHTRGEYPGYALRYFRENGIELQITEQDRELLAAHT
VDFVSFSYYMSICETGDPARRLAGAGNIMGGVPNPHLPASEWGWQIDPVGLRVILNQFWD
RWGKPLFIVENGLGARDELVESADAVDGFTVLDDYRIDYLRAHLQQVGEAIADGVQVLGY
TSWGPIDLVSASTAQMSKRYGFIYVDRNDDGTGTLARYRKKSFHWYAQVIATNGATLRQN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcatttccgcaccaacgcagttcccgcccggcttcctgtggggcggcgccacc
gccgccaaccaggtggagggcggctacgaccagggcggcaagggcctgtccatccaggac
gtgatgccccagggcatcgtcggtccgcgcaccgacggccccaccccggagaacctcaag
ctgaccggcatcgacttctaccaccgctatgccgaggacatcgccctgttcgccgagatg
ggcttctcggtctaccggttctccatcgcctggagccggatcttcccgggcggtgacgac
gccgagcccaacgaggagggcctggccttctacgaccgggtgctcgacgagctggagcgg
cacggcatcgagccgctgatcacgctgtcgcactacgagaccccgctggccatcgccgag
aagtacgacggctgggtctcccgggacgtcatcgccctgttcgagcggtacgtgcgggtc
gtgttcgcccgctacggccaccgggtgaagtactggctgaccttcaacgagatcaactcg
gtgatccacgcgccgttcatgagcggcggcatcaacacccccaaggacgagctgaccccg
accgacctgtaccaggcgatccaccatgagctggtggccagcgcgctggccaccaagatc
gcgcacgagaccgacccgcagatcaaggtcggctgcatggtgctgggcatgccgatctac
ccgctgtcccccgacccgaacgatctgctggcgtcgatgaccgccgatcacgccaacctg
atgttcagcgacgtgcacacccgcggcgagtaccccggatacgccctgcggtacttccgg
gagaacggcatcgagctgcagatcaccgaacaggaccgggaactgctggccgcgcacacc
gtcgacttcgtctcgttcagctactacatgagcatctgcgagaccggggatccggccagg
cgcctggccggtgcgggcaacatcatgggcggggtgccgaacccgcacctgccggcctcc
gaatggggctggcagatcgacccggtcgggcttcgggtcatcctcaaccagttctgggac
cgctggggcaagccgctgttcatcgtcgagaacgggctcggcgcccgggacgagctggtc
gagtcggctgacgccgtcgacggtttcaccgtcctggacgactaccggatcgactacctg
cgcgcgcatctgcagcaggtcggcgaggccatcgccgacggcgtccaggtgctgggctac
accagttggggcccgatcgatctggtcagcgcctcgaccgcgcagatgtccaagcggtac
gggttcatctacgtcgaccgcaacgacgacggcaccggcacgctggcccgctaccgcaag
aagtcgttccactggtacgcgcaggtcatcgcgaccaacggcgccaccctccggcagaac
tga

DBGET integrated database retrieval system