KEGG   Nakamurella multipartita: Namu_0998Help
Entry
Namu_0998         CDS       T00991                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
nml  Nakamurella multipartita
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Namu_0998
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Namu_0998
   00630 Glyoxylate and dicarboxylate metabolism
    Namu_0998
Enzymes [BR:nml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Namu_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1095354..1097042)
Genome map
AA seq 562 aa AA seqDB search
MFGPPKAPKIKGIMHPRFDEILTPEALAFLAKLDGASAGRRADLLAARRERSKRIAGGEP
VDFLAETASVREDAAWQVAAPAPGLEDRRCEITGPTSRKMSINALNSGARVWMADFEDAT
APSWFNVVDGQLNLFDAIRGNLDFTDENGKEYKVGEKTPTIVVRPRGWRLCEKHLTIDGR
PLPASLVDFGLFFFHNAQALIDAGAGPYFYLPKLESHLEARLWNDIFVQAQALLGIPQGT
IRATVLIETLPAAFEMEEILYELRDHSSGLNAGRWDYIFSYIKTFANSGPEYVLPDRANV
TMTTPMMRAYTELLVSTCHKRGAHAIGGMAAFVPNKADPQVTEQALAKVKADKEREAADG
FDGSWVAHPGLVATCTAAFDAVLGDRPNQLDKQRPDVHVTAADIVNPGSTPGQVTLAGLR
TNIAVALRYLTAWVSEQGAVAIDNLMEDAATVEISRTQVWQWLHYKTKLAEGLVVTRKLV
DELIEHEVAELHAQAKDERAHRHVDEARDVFAEAALGDDLPGFFTPYAYVRYLIARPLQP
TGPIGPDDLRMSERVPREHQPA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgttcggaccgcccaaggccccgaagatcaagggcatcatgcatccccggttcgacgag
atcctcaccccggaggcattggcgttcctggccaagctggacggggcctcggccggccgg
cgcgcggacctgctggccgcgcggcgcgagcggagcaagcgcatcgccggcggtgagccg
gtcgacttcctggccgagaccgcctcggtgcgtgaggatgccgcctggcaggtcgccgca
ccggcgcccggactggaggaccgccgctgcgagatcaccggcccgaccagccgcaagatg
agcatcaacgcgctcaactccggcgcccgggtgtggatggccgacttcgaggacgcgacg
gcgccgagctggttcaacgtggtcgacgggcagctgaacctgttcgacgcgatccgcggg
aacctggacttcaccgacgagaacggcaaggaatacaaggtcggcgagaagaccccgacc
atcgtcgtccgcccccggggctggcggctgtgcgagaagcacctgacgatcgacggccgg
ccgctgcccgcgtccctggtcgacttcggcctgttcttcttccacaacgcgcaggcgctg
atcgacgccggggcgggtccgtacttctacctgcccaagctggagtcgcacctggaggcg
cggctctggaacgacatcttcgtccaggcgcaggccctgctcggcatcccgcagggcacc
atccgggcgacggtgctgatcgagaccctgccggccgcgttcgagatggaggagatcctc
tacgagctgcgcgaccactcctccggcctgaacgccggccgctgggactacatcttcagc
tacatcaagaccttcgccaacagcggtccggagtacgtgctgccggatcgggccaacgtc
acgatgaccacgccgatgatgcgtgcctacaccgagctgctggtctcgacctgccataag
cggggcgcccacgcgatcggcggcatggccgcgttcgtgccgaacaaggccgacccgcag
gtcaccgagcaggccctggccaaggtcaaggccgacaaggagcgggaggccgccgacggc
ttcgacggctcgtgggtggcgcaccccggcctggtggcgacctgcaccgccgcgttcgac
gcggtgctgggcgaccggcccaaccagctcgacaagcagcgtccggacgtgcacgtcacc
gccgcggacatcgtcaacccgggttcgaccccgggccaggtcaccctggccgggctgcgc
accaacatcgcggtcgccctgcgctacctgaccgcgtgggtgtccgagcagggtgcggtg
gcgatcgacaacctgatggaggacgccgccaccgtcgagatctcccgcacccaggtgtgg
cagtggctgcactacaagaccaagctcgccgagggcctggtggtcacccgcaagctggtc
gacgagctgatcgagcacgaggtcgccgagctgcatgcccaggccaaggacgagcgggcc
caccggcacgtcgacgaggcgcgggacgtcttcgccgaggcggccctgggtgacgacctg
cccggcttcttcaccccgtacgcctacgtgcggtatctgatcgcccggccgctgcagccg
accggcccgatcggccccgacgacctgcggatgtccgagcgcgttccgcgggagcaccag
cccgcctga

DBGET integrated database retrieval system