KEGG   Nakamurella multipartita: Namu_0998Help
Entry
Namu_0998         CDS       T00991                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
nml  Nakamurella multipartita
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Namu_0998
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Namu_0998
   00630 Glyoxylate and dicarboxylate metabolism
    Namu_0998
Enzymes [BR:nml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Namu_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1095354..1097042)
Genome map
AA seq 562 aa AA seqDB search
MFGPPKAPKIKGIMHPRFDEILTPEALAFLAKLDGASAGRRADLLAARRERSKRIAGGEP
VDFLAETASVREDAAWQVAAPAPGLEDRRCEITGPTSRKMSINALNSGARVWMADFEDAT
APSWFNVVDGQLNLFDAIRGNLDFTDENGKEYKVGEKTPTIVVRPRGWRLCEKHLTIDGR
PLPASLVDFGLFFFHNAQALIDAGAGPYFYLPKLESHLEARLWNDIFVQAQALLGIPQGT
IRATVLIETLPAAFEMEEILYELRDHSSGLNAGRWDYIFSYIKTFANSGPEYVLPDRANV
TMTTPMMRAYTELLVSTCHKRGAHAIGGMAAFVPNKADPQVTEQALAKVKADKEREAADG
FDGSWVAHPGLVATCTAAFDAVLGDRPNQLDKQRPDVHVTAADIVNPGSTPGQVTLAGLR
TNIAVALRYLTAWVSEQGAVAIDNLMEDAATVEISRTQVWQWLHYKTKLAEGLVVTRKLV
DELIEHEVAELHAQAKDERAHRHVDEARDVFAEAALGDDLPGFFTPYAYVRYLIARPLQP
TGPIGPDDLRMSERVPREHQPA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgttcggaccgcccaaggccccgaagatcaagggcatcatgcatccccggttcgacgag
atcctcaccccggaggcattggcgttcctggccaagctggacggggcctcggccggccgg
cgcgcggacctgctggccgcgcggcgcgagcggagcaagcgcatcgccggcggtgagccg
gtcgacttcctggccgagaccgcctcggtgcgtgaggatgccgcctggcaggtcgccgca
ccggcgcccggactggaggaccgccgctgcgagatcaccggcccgaccagccgcaagatg
agcatcaacgcgctcaactccggcgcccgggtgtggatggccgacttcgaggacgcgacg
gcgccgagctggttcaacgtggtcgacgggcagctgaacctgttcgacgcgatccgcggg
aacctggacttcaccgacgagaacggcaaggaatacaaggtcggcgagaagaccccgacc
atcgtcgtccgcccccggggctggcggctgtgcgagaagcacctgacgatcgacggccgg
ccgctgcccgcgtccctggtcgacttcggcctgttcttcttccacaacgcgcaggcgctg
atcgacgccggggcgggtccgtacttctacctgcccaagctggagtcgcacctggaggcg
cggctctggaacgacatcttcgtccaggcgcaggccctgctcggcatcccgcagggcacc
atccgggcgacggtgctgatcgagaccctgccggccgcgttcgagatggaggagatcctc
tacgagctgcgcgaccactcctccggcctgaacgccggccgctgggactacatcttcagc
tacatcaagaccttcgccaacagcggtccggagtacgtgctgccggatcgggccaacgtc
acgatgaccacgccgatgatgcgtgcctacaccgagctgctggtctcgacctgccataag
cggggcgcccacgcgatcggcggcatggccgcgttcgtgccgaacaaggccgacccgcag
gtcaccgagcaggccctggccaaggtcaaggccgacaaggagcgggaggccgccgacggc
ttcgacggctcgtgggtggcgcaccccggcctggtggcgacctgcaccgccgcgttcgac
gcggtgctgggcgaccggcccaaccagctcgacaagcagcgtccggacgtgcacgtcacc
gccgcggacatcgtcaacccgggttcgaccccgggccaggtcaccctggccgggctgcgc
accaacatcgcggtcgccctgcgctacctgaccgcgtgggtgtccgagcagggtgcggtg
gcgatcgacaacctgatggaggacgccgccaccgtcgagatctcccgcacccaggtgtgg
cagtggctgcactacaagaccaagctcgccgagggcctggtggtcacccgcaagctggtc
gacgagctgatcgagcacgaggtcgccgagctgcatgcccaggccaaggacgagcgggcc
caccggcacgtcgacgaggcgcgggacgtcttcgccgaggcggccctgggtgacgacctg
cccggcttcttcaccccgtacgcctacgtgcggtatctgatcgcccggccgctgcagccg
accggcccgatcggccccgacgacctgcggatgtccgagcgcgttccgcgggagcaccag
cccgcctga

DBGET integrated database retrieval system