KEGG   Nakamurella multipartita: Namu_1265Help
Entry
Namu_1265         CDS       T00991                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nml  Nakamurella multipartita
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Namu_1265 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Namu_1265 (sucC)
   00640 Propanoate metabolism
    Namu_1265 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Namu_1265 (sucC)
Enzymes [BR:nml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Namu_1265 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1388078..1389280
Genome map
AA seq 400 aa AA seqDB search
MDLYEYQAKELFVAHGVPAPAGRVARTVEEAVAAAQELGVPVMVKSQVKIGGRGKAGGVK
FAATLDDVRTHAGNILGLDIKGHVTRQVLITPASEIAQEYYVSYLLDRSNRTFLAMATKD
GGMEIEQLAEERPDALARIPVNALTGVDAEKAKEIAAAGKFPADVVDQVEAVLVGLWDTF
VGEDATLVEVNPLVKDGEGKVVALDGKVSLDANADFRHPEHAALADTAAENPLEVAAKEK
GLNYVKLDGDVGIIGNGAGLVMSTLDVVAYAGEAHGGVKPANFLDIGGGASAEVMANGLE
IILSDPDVKAVFVNVFGGITACDAVANGIVGALKMLGDEATKPLVVRLDGNNVLEGRAIL
NEANHPLVIQAETMDEGADKAAELAHQSGAAALNSTSTGV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgtacgagtaccaggcgaaggaactcttcgtcgcgcatggtgtgcccgctccg
gccggccgggtggcgcgcaccgtggaggaagcggtagccgcggcccaggagctgggcgtg
ccggtgatggtgaagtcgcaggtgaagatcggcggccggggcaaggccggcggcgtgaag
ttcgccgccaccctggacgacgtgcgcacccatgcgggcaacatcctgggcctggacatc
aagggccacgtgacccggcaggtgctgatcaccccggcgagcgagatcgcgcaggagtac
tacgtctcctacctgctggaccggtcgaaccggaccttcctggccatggccaccaaggac
ggcggcatggagatcgagcagctggccgaggagcggccggacgccctggcccggatcccg
gtcaacgcgctgaccggcgtcgacgccgagaaggccaaggagatcgccgctgccggcaag
ttcccggccgacgtcgtcgaccaggtcgaggccgtgctggtcgggctgtgggacaccttc
gtcggcgaggacgccaccctggtcgaggtgaacccgctggtcaaggacggcgagggcaag
gtcgtcgcgctcgacggcaaggtctcgctggacgccaacgcggacttccggcacccggag
catgcggcactggccgacaccgcggcggagaacccgctggaggtcgcggccaaggaaaag
ggtctgaactacgtcaagctggacggtgacgtcggcatcatcggcaacggcgccggcctg
gtcatgtccacgctcgatgtcgtcgcctacgccggtgaggcccacggcggggtcaagccg
gccaacttcctggacatcggcggcggcgccagcgccgaggtgatggccaacgggctggag
atcatcctgtccgacccggacgtcaaggcggtgttcgtcaacgtcttcggcggcatcacc
gcgtgcgacgcggtggccaacggcatcgtcggcgccctgaagatgctcggtgacgaggcc
accaagccgctggtcgtccggttggacggcaacaacgtgctggagggtcgggcgatcctc
aacgaggcgaaccacccgctggtcatccaggccgagacgatggacgagggcgcggacaag
gccgccgagctggcccaccaatccggcgcggccgccctgaacagcacgagcacgggagtc
tga

DBGET integrated database retrieval system