KEGG   Nakamurella multipartita: Namu_1265Help
Entry
Namu_1265         CDS       T00991                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nml  Nakamurella multipartita
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Namu_1265
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Namu_1265
   00640 Propanoate metabolism
    Namu_1265
   00660 C5-Branched dibasic acid metabolism
    Namu_1265
Enzymes [BR:nml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Namu_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1388078..1389280
Genome map
AA seq 400 aa AA seqDB search
MDLYEYQAKELFVAHGVPAPAGRVARTVEEAVAAAQELGVPVMVKSQVKIGGRGKAGGVK
FAATLDDVRTHAGNILGLDIKGHVTRQVLITPASEIAQEYYVSYLLDRSNRTFLAMATKD
GGMEIEQLAEERPDALARIPVNALTGVDAEKAKEIAAAGKFPADVVDQVEAVLVGLWDTF
VGEDATLVEVNPLVKDGEGKVVALDGKVSLDANADFRHPEHAALADTAAENPLEVAAKEK
GLNYVKLDGDVGIIGNGAGLVMSTLDVVAYAGEAHGGVKPANFLDIGGGASAEVMANGLE
IILSDPDVKAVFVNVFGGITACDAVANGIVGALKMLGDEATKPLVVRLDGNNVLEGRAIL
NEANHPLVIQAETMDEGADKAAELAHQSGAAALNSTSTGV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtggatctgtacgagtaccaggcgaaggaactcttcgtcgcgcatggtgtgcccgctccg
gccggccgggtggcgcgcaccgtggaggaagcggtagccgcggcccaggagctgggcgtg
ccggtgatggtgaagtcgcaggtgaagatcggcggccggggcaaggccggcggcgtgaag
ttcgccgccaccctggacgacgtgcgcacccatgcgggcaacatcctgggcctggacatc
aagggccacgtgacccggcaggtgctgatcaccccggcgagcgagatcgcgcaggagtac
tacgtctcctacctgctggaccggtcgaaccggaccttcctggccatggccaccaaggac
ggcggcatggagatcgagcagctggccgaggagcggccggacgccctggcccggatcccg
gtcaacgcgctgaccggcgtcgacgccgagaaggccaaggagatcgccgctgccggcaag
ttcccggccgacgtcgtcgaccaggtcgaggccgtgctggtcgggctgtgggacaccttc
gtcggcgaggacgccaccctggtcgaggtgaacccgctggtcaaggacggcgagggcaag
gtcgtcgcgctcgacggcaaggtctcgctggacgccaacgcggacttccggcacccggag
catgcggcactggccgacaccgcggcggagaacccgctggaggtcgcggccaaggaaaag
ggtctgaactacgtcaagctggacggtgacgtcggcatcatcggcaacggcgccggcctg
gtcatgtccacgctcgatgtcgtcgcctacgccggtgaggcccacggcggggtcaagccg
gccaacttcctggacatcggcggcggcgccagcgccgaggtgatggccaacgggctggag
atcatcctgtccgacccggacgtcaaggcggtgttcgtcaacgtcttcggcggcatcacc
gcgtgcgacgcggtggccaacggcatcgtcggcgccctgaagatgctcggtgacgaggcc
accaagccgctggtcgtccggttggacggcaacaacgtgctggagggtcgggcgatcctc
aacgaggcgaaccacccgctggtcatccaggccgagacgatggacgagggcgcggacaag
gccgccgagctggcccaccaatccggcgcggccgccctgaacagcacgagcacgggagtc
tga

DBGET integrated database retrieval system