KEGG   Nakamurella multipartita: Namu_1310Help
Entry
Namu_1310         CDS       T00991                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic anchor subunit-like protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nml  Nakamurella multipartita
Pathway
nml00020  Citrate cycle (TCA cycle)
nml00190  Oxidative phosphorylation
nml00650  Butanoate metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01200  Carbon metabolism
Module
nml_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nml_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nml_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Namu_1310
   00650 Butanoate metabolism
    Namu_1310
  Energy metabolism
   00190 Oxidative phosphorylation
    Namu_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Ninjurin
Motif
Other DBs
NCBI-ProteinID: ACV77713
UniProt: C8XDP9
Position
complement(1439179..1439610)
Genome map
AA seq 143 aa AA seqDB search
MTAAFDPPATRGIVAPRAPRKRVTGRRSSFEMYSWMFMRLSGIVLVVLVLGHLLIMNVLD
GGVHRINWGFVAGRWASPFWQIWDLLMLWLAELHGANGLRTVINDYARKDGTRFWLQLLL
LISVVLTLAVGTLVIFTFDPTMS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgcgttcgatccgccggccacccgcggcatcgtggccccgcgggccccgcgc
aagcgggtcaccgggcgccgcagcagcttcgagatgtactcgtggatgttcatgcggttg
tccgggatcgtgctggtggtcctggttctgggccacctgctgatcatgaacgtgctcgac
ggcggggtgcaccggatcaactggggcttcgtggccggccgctgggccagcccgttctgg
cagatctgggacctgctgatgctgtggttggccgagctgcacggggccaacggcctgcgc
acggtgatcaacgactacgcccgcaaggacggcacccggttctggctgcagctgctgctg
ctgatctcggtcgtgctgacgctggcggtgggcacgctggtgatcttcactttcgatccc
acgatgagctga

DBGET integrated database retrieval system