KEGG   Nakamurella multipartita: Namu_1310Help
Entry
Namu_1310         CDS       T00991                                 

Definition
succinate dehydrogenase hydrophobic anchor subunit-like protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nml  Nakamurella multipartita
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Namu_1310
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Namu_1310
   00650 Butanoate metabolism
    Namu_1310
  Energy metabolism
   00190 Oxidative phosphorylation
    Namu_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1439179..1439610)
Genome map
AA seq 143 aa AA seqDB search
MTAAFDPPATRGIVAPRAPRKRVTGRRSSFEMYSWMFMRLSGIVLVVLVLGHLLIMNVLD
GGVHRINWGFVAGRWASPFWQIWDLLMLWLAELHGANGLRTVINDYARKDGTRFWLQLLL
LISVVLTLAVGTLVIFTFDPTMS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgcgttcgatccgccggccacccgcggcatcgtggccccgcgggccccgcgc
aagcgggtcaccgggcgccgcagcagcttcgagatgtactcgtggatgttcatgcggttg
tccgggatcgtgctggtggtcctggttctgggccacctgctgatcatgaacgtgctcgac
ggcggggtgcaccggatcaactggggcttcgtggccggccgctgggccagcccgttctgg
cagatctgggacctgctgatgctgtggttggccgagctgcacggggccaacggcctgcgc
acggtgatcaacgactacgcccgcaaggacggcacccggttctggctgcagctgctgctg
ctgatctcggtcgtgctgacgctggcggtgggcacgctggtgatcttcactttcgatccc
acgatgagctga

DBGET integrated database retrieval system