KEGG   Nakamurella multipartita: Namu_1318Help
Entry
Namu_1318         CDS       T00991                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
nml  Nakamurella multipartita
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nml00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1446805..1448094
Genome map
AA seq 429 aa AA seqDB search
MSTFAAVDIIRAKRDGQELRTEQIQWVIDAYTRHEVAEEQMSALLMAILLNGMSGAEIAA
WTTAMIESGRRMDLSAVPRPTVDKHSTGGVGDKISLPLVPLVAACGAAVPQLSGRGLGHT
GGTLDKMESIAGWRATLSPQEMTDQLSTLGAVICAASEDLAPADRKLYALRDVTGTVESI
PMIAASIMSKKIAEGTSALVLDVKVGTGAFMKRADHAAELARTMVELGTREGVRTSALLT
DMSTPLGVAVGNAIEVAESVEVLAGGGPADVVELTVALARQMVELAGLSVDPADVLASGQ
AMDCWRAMVSAQGGDPDAPLPTPRFREVVVADEAGVVAELDALPVGLAAWRLGAGRARKE
HAVQAAAGVLCLAKPGQTVRIGQPLFELHTNTPDKFPAALADLDGAIRIAPAGTTVHRPA
LVQDVITAG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttcgccgcggtggacatcatccgggccaagcgggacggtcaggagctgcgc
accgagcagatccagtgggtgatcgacgcctacacccggcacgaggtggccgaggagcag
atgtcggcgctgctgatggccatcctgctcaacgggatgtccggtgccgagatcgccgcc
tggaccaccgccatgatcgagtccggccggcggatggacctgtccgccgtgccccggccg
accgtggacaagcactccaccggcggggtgggggacaagatctccttgccgctggtcccg
ctggtcgccgcgtgcggggcggccgtgccgcagctgtccggccgcgggttgggccacacc
ggcggcaccctggacaagatggagtcgatcgccgggtggcgggccaccctgtccccgcag
gagatgaccgaccagctcagcaccctcggcgccgtcatctgcgccgcgtcggaggacctg
gccccggccgaccgcaagctctacgcgctgcgggacgtcaccgggaccgtcgaatcgatc
ccgatgatcgccgcgtcgatcatgagcaagaagattgccgagggcacctcggccctggtg
ctggacgtcaaggtcggcaccggcgcgttcatgaagcgggccgaccacgccgccgagctc
gcccgcaccatggtcgaactcgggacccgggaaggggtccggaccagcgcgctgctcacc
gacatgtccaccccgctgggggtggcggtgggcaacgcgatcgaggtcgccgaatcggtc
gaggtgctggccggtggcgggccggccgatgtggtcgagctgacggtcgcactggcccgg
cagatggttgagctggccgggctgtcggtcgacccggccgacgtgctggcctccgggcag
gccatggactgctggcgggcgatggtcagcgcccagggcggcgacccggacgcgccgctg
cccacgccccggttccgcgaggtggtggtcgccgacgaggcgggggtggtcgccgagctg
gacgcgctgcccgtcggcctggccgcctggcggctgggtgccggccgggcccgcaaggag
catgccgtgcaggccgccgccggggtgctgtgcctggccaagccggggcagaccgtgcgg
atcggccagccgctgttcgagctgcacaccaacaccccggacaagttcccggccgccctg
gccgacctggacggtgcgatccggatcgcccccgcgggcaccaccgtgcaccggcccgcg
ctcgtccaggacgtgatcaccgccggctga

DBGET integrated database retrieval system