KEGG   Nakamurella multipartita: Namu_1318Help
Entry
Namu_1318         CDS       T00991                                 

Definition
(GenBank) pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
nml  Nakamurella multipartita
Pathway
nml00240  Pyrimidine metabolism
nml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Namu_1318
Enzymes [BR:nml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Namu_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-ProteinID: ACV77721
UniProt: C8XDQ7
Position
1446805..1448094
Genome map
AA seq 429 aa AA seqDB search
MSTFAAVDIIRAKRDGQELRTEQIQWVIDAYTRHEVAEEQMSALLMAILLNGMSGAEIAA
WTTAMIESGRRMDLSAVPRPTVDKHSTGGVGDKISLPLVPLVAACGAAVPQLSGRGLGHT
GGTLDKMESIAGWRATLSPQEMTDQLSTLGAVICAASEDLAPADRKLYALRDVTGTVESI
PMIAASIMSKKIAEGTSALVLDVKVGTGAFMKRADHAAELARTMVELGTREGVRTSALLT
DMSTPLGVAVGNAIEVAESVEVLAGGGPADVVELTVALARQMVELAGLSVDPADVLASGQ
AMDCWRAMVSAQGGDPDAPLPTPRFREVVVADEAGVVAELDALPVGLAAWRLGAGRARKE
HAVQAAAGVLCLAKPGQTVRIGQPLFELHTNTPDKFPAALADLDGAIRIAPAGTTVHRPA
LVQDVITAG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttcgccgcggtggacatcatccgggccaagcgggacggtcaggagctgcgc
accgagcagatccagtgggtgatcgacgcctacacccggcacgaggtggccgaggagcag
atgtcggcgctgctgatggccatcctgctcaacgggatgtccggtgccgagatcgccgcc
tggaccaccgccatgatcgagtccggccggcggatggacctgtccgccgtgccccggccg
accgtggacaagcactccaccggcggggtgggggacaagatctccttgccgctggtcccg
ctggtcgccgcgtgcggggcggccgtgccgcagctgtccggccgcgggttgggccacacc
ggcggcaccctggacaagatggagtcgatcgccgggtggcgggccaccctgtccccgcag
gagatgaccgaccagctcagcaccctcggcgccgtcatctgcgccgcgtcggaggacctg
gccccggccgaccgcaagctctacgcgctgcgggacgtcaccgggaccgtcgaatcgatc
ccgatgatcgccgcgtcgatcatgagcaagaagattgccgagggcacctcggccctggtg
ctggacgtcaaggtcggcaccggcgcgttcatgaagcgggccgaccacgccgccgagctc
gcccgcaccatggtcgaactcgggacccgggaaggggtccggaccagcgcgctgctcacc
gacatgtccaccccgctgggggtggcggtgggcaacgcgatcgaggtcgccgaatcggtc
gaggtgctggccggtggcgggccggccgatgtggtcgagctgacggtcgcactggcccgg
cagatggttgagctggccgggctgtcggtcgacccggccgacgtgctggcctccgggcag
gccatggactgctggcgggcgatggtcagcgcccagggcggcgacccggacgcgccgctg
cccacgccccggttccgcgaggtggtggtcgccgacgaggcgggggtggtcgccgagctg
gacgcgctgcccgtcggcctggccgcctggcggctgggtgccggccgggcccgcaaggag
catgccgtgcaggccgccgccggggtgctgtgcctggccaagccggggcagaccgtgcgg
atcggccagccgctgttcgagctgcacaccaacaccccggacaagttcccggccgccctg
gccgacctggacggtgcgatccggatcgcccccgcgggcaccaccgtgcaccggcccgcg
ctcgtccaggacgtgatcaccgccggctga

DBGET integrated database retrieval system