KEGG   Nakamurella multipartita: Namu_1531Help
Entry
Namu_1531         CDS       T00991                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nml  Nakamurella multipartita
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nml00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1689083..1690597
Genome map
AA seq 504 aa AA seqDB search
MSGSVVMAMDAGTTGIRAILFDKAGEVVAEASQEFRQIYPQSGWVEHDPVDIWNTQLTVA
HKVLDVAGLAADQVAAIGITNQRETTVVWDRHTGHPVYNAIVWQDRRTAGRCDELKAWGL
TDHVRRTTGLVIDAYFSGTKIDWILRNVPGARERAAAGDLLFGTVDSWLIWNLTGGAGSS
AAVHVTDYSNASRTMLFDINRLDWDPTMLAELDIPRSMLPQVRPTSEIFGHTDASVFFGV
PVPVAAAVGDQHAALFGQACFEPGMIKSTYGTGASLLMNTGERPVFSDKGLLTTVAWGVD
GQVQYALEGLIFVSAASIQWLRDELKIIYDSADTEYAALRVPDSGGVYFVPAFVGLAAPY
WDPYARGGILGLSFGVNRNHVIRAALEAIAYQIRDLTDAMQTDSGIPLVEVKVDGGASKN
NFLMQFQADLLGVPALRPVVTESSARGAAFLAGLAVGFWADRAELVDSFRLDRRFEPAMK
ADEADRLHAGWLRAVERVRDWEEH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcagcgtcgtgatggcgatggacgccggcaccaccggcatccgggccatcctg
ttcgacaaggccggcgaggtcgtcgccgaggccagccaggagttccggcagatctacccg
cagtccggctgggtcgagcacgacccggtggacatctggaacacccagctgacggtggcg
cacaaggtcctcgacgtggccggcctggccgccgaccaagtggccgccatcggcatcacc
aaccagcgggagaccaccgtggtctgggaccggcacaccggccacccggtctacaacgcc
atcgtctggcaggaccggcgtaccgccggccggtgtgacgagctcaaggcttgggggctg
accgatcacgtccggcggaccaccgggctggtcatcgacgcgtacttctccggcaccaag
atcgactggatcctgcgcaacgtgcccggggcgcgcgagcgggcggccgccggcgacctg
ctcttcggcacggtcgacagctggctgatctggaacctgaccggcggcgcgggatcgtcg
gcggcggtgcacgtcaccgactactccaacgcctcgcgcaccatgctgttcgacatcaac
cggctcgactgggacccgaccatgctggccgagctggacatcccgcggtcgatgctgccg
caggtgcggccgaccagcgagatcttcggccacaccgacgcatcggtgttcttcggcgtc
cccgtcccggtcgccgcggcggtcggcgatcagcatgccgccctgttcggccaggcctgc
ttcgaacccggcatgatcaagtccacctacggcaccggtgcctccctgctgatgaacacc
ggtgagcggccggtgttctcggacaagggcctgctgaccacggtcgcctggggcgtggac
gggcaggtccagtacgccctggagggactgatcttcgtctccgccgccagcatccagtgg
ctgcgggacgagctgaagatcatctacgactcggccgacaccgagtacgcggcgctgcgg
gtcccggactcgggcggggtctacttcgtccccgcgttcgtcgggctggccgcgccctac
tgggacccctacgcccgcggcggcatcctgggcctgagcttcggggtgaaccgcaaccac
gtcatccgcgcggcgctggaggccatcgcctaccagatccgggatctgaccgacgccatg
cagaccgattccggcatcccgctggtcgaggtcaaggtggacggcggcgcctcgaagaac
aacttcctcatgcagttccaggccgatctgctcggggtgcccgcgctgcggcccgtcgtc
accgagtcctccgcccgcggcgcggccttcctggccggcctggccgtcgggttctgggcc
gatcgggccgaactggtcgattccttccggctggaccgccggttcgaaccggccatgaag
gccgacgaggccgaccggttacatgccggctggctgcgggccgtcgagcgggtccgcgac
tgggaggagcactga

DBGET integrated database retrieval system