KEGG   Nakamurella multipartita: Namu_1542Help
Entry
Namu_1542         CDS       T00991                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
nml  Nakamurella multipartita
Pathway
nml00860  Porphyrin and chlorophyll metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
Module
nml_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Namu_1542
Enzymes [BR:nml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Namu_1542
Exosome [BR:nml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Namu_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMS28_porin SH3_6
Motif
Other DBs
NCBI-ProteinID: ACV77937
UniProt: C8XF51
Position
complement(1702702..1703691)
Genome map
AA seq 329 aa AA seqDB search
MYPTVRPRRLRRTAPIRRLVRETRLHPADLVLPVFLKQSLTEPAPLTSMPGVLQHTRDSL
RRAAAEAVAAGVGGLMVFGVPSVRDAVGSQATDPAGILNLAMADLRAEVGPDTVLMADLC
LDEFTDHGHCGVLTADGAVDNDATLLRYREMAVALAEAGSDMVGTSGMMDGQVGAVRDAL
DTTGHTDTAVFAYGAKYASAFYGPFREAVDSALQGDRRTYQQDPANRREAAREVALDVAE
GADLIMVKPAMAYLDVLSDVAAATTVPVAAYQVSGEYAMIEAAAANGWIDRNRAIAETLT
GIRRAGAQIVLTYWAAEVAAELSAGRDFS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtatccgaccgtccgtccccggcgactgcggcgcaccgcgcccatccgccggctcgtg
cgcgagacccggctgcacccggccgatctcgtgctgccggtgttcctcaagcagtcgctg
accgagcccgccccgctgacctcgatgcccggggtgctccagcacacccgggattcgctg
cgccgggcggccgccgaggcggtggccgccggggtgggcggtttgatggtgttcggggtg
ccctcggtccgcgacgccgtcggctcccaggccaccgacccggccggcattctcaacctg
gccatggccgacctgcgagccgaggtgggcccggacacggtgctgatggccgacctgtgc
ctggacgagttcaccgaccacgggcactgcggggtgctcaccgccgacggcgcggtcgac
aacgacgccaccctgctgcgctaccgggagatggccgtggccctggccgaggccggcagc
gacatggtcggcacctccgggatgatggacggccaggtcggcgcggtccgcgacgccctg
gacaccaccggccacaccgacaccgcggtcttcgcctacggggccaagtacgcctcggcg
ttctacggcccgttccgggaggccgtcgactcggccctgcagggcgaccggcgcacctac
cagcaggatccggccaaccggcgggaggccgcccgggaggtggcgctggacgttgccgag
ggcgccgacctgatcatggtcaagccggccatggcctacctggacgtgctctcagacgtg
gccgccgcgaccacggttccggtggctgcgtatcaggtctcgggcgagtacgcgatgatc
gaggcggccgcggcgaacgggtggatcgaccggaaccgggcgatcgccgagacgttgacc
ggcatccggcgggccggcgcgcagatcgtgctgacctactgggcggccgaggtggcggcg
gaactgtccgccgggagggatttctcgtga

DBGET integrated database retrieval system