KEGG   Nakamurella multipartita: Namu_1550Help
Entry
Namu_1550         CDS       T00991                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nml  Nakamurella multipartita
Pathway
nml00260  Glycine, serine and threonine metabolism
nml00750  Vitamin B6 metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01230  Biosynthesis of amino acids
Module
nml_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Namu_1550
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Namu_1550
Enzymes [BR:nml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Namu_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF4339
Motif
Other DBs
NCBI-ProteinID: ACV77945
UniProt: C8XF59
Position
complement(1711462..1712751)
Genome map
AA seq 429 aa AA seqDB search
MTSVLSTPGSAGSASAPGIDLGPAVALSCRECGNRVELGPYYACMECFGPLEVAYEFTLR
GDALKQRIESGPANIWRYADLLPVPADVAQTPNMNPGNTKLIRADNLAKELGMRRLWVKD
DSGNPTHSFKDRVVAVALAAARKLGFTVLACPSTGNLANAVAAAAARAGIRSVVLIPANL
EQQKILTTAAYGGTLVAVDGNYDDINRLAGEIAAEQEDWAFVNVNVRPYYAEGSKTLGFE
VAEQLGWRLPEQVVIPIASGAQLVKVDKGFTELGELGLVEPTPYKVFGAQATGCSPVSEA
FKQGWDVVKPVRPDTIAKSLAIGNPADGPYVLDVTRRTGGAIEDVSDDEVIAGIKLLART
EGIFGETAGGVTIATLRKLLASGQLDPEAETVVFNTGDGLKTLDAIAGEVGPTATIKPTL
GAFEAAGLA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgtgctgtccacccccgggtccgccggttccgcctccgcgcccggcatcgat
ctgggtcccgccgtcgcgctgtcctgtcgcgagtgcggcaaccgcgtcgaactgggcccg
tactacgcgtgtatggagtgtttcgggccgctcgaggtggcctacgagttcaccttgcgc
ggcgacgccctcaagcagcggatcgagtccggtccggcgaacatctggcggtacgccgac
ctgttgccggtgccggccgacgtcgcacagaccccgaacatgaacccgggcaacaccaag
ctgatccgggccgacaacctggccaaggagctgggcatgcgccggctctgggtcaaggac
gactccgggaacccgacccactcgttcaaggaccgcgtcgtcgccgtcgcgctggccgcg
gcccgcaagctcggcttcaccgtgctggcctgcccgagcaccggcaacctggccaacgcg
gtcgccgcggccgccgcccgggccggcatccggtccgtcgtgctgatcccggccaatctg
gagcagcagaagatcctgaccaccgccgcctacggcggcaccctggtcgcggtcgacggc
aactacgacgacatcaaccggctggccggcgagatcgccgccgagcaggaggactgggcg
ttcgtcaacgtcaacgtccggccctactacgccgagggctccaagaccctgggcttcgag
gtcgccgagcagctcggctggcggctgcccgagcaggtcgtcatccccatcgcctccggc
gcgcagctggtcaaggtggacaagggcttcaccgagctgggcgagctgggcctggtcgaa
cccacgccgtacaaggtgttcggtgcccaggcgaccggctgctcgccggtgtccgaggcg
ttcaagcagggctgggacgtggtcaagccggtccggccggacaccatcgccaagtcgctg
gccatcggcaacccggcggacggcccgtacgtgctggacgtgacccggcgcaccggcggg
gcgatcgaggacgtcagcgacgacgaggtgatcgccggcatcaagctgctggcccgcacc
gagggcatcttcggcgagaccgccggcggcgtcaccatcgccaccctgcgcaagctgctg
gccagcggccagctcgaccccgaggccgagaccgtggtgttcaacaccggtgacggcctc
aagacgctggacgcgatcgccggcgaggtcgggccgaccgcgacgatcaagccgaccctg
ggtgcgttcgaggcggccggactggcctga

DBGET integrated database retrieval system