KEGG   Nakamurella multipartita: Namu_1767Help
Entry
Namu_1767         CDS       T00991                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nml  Nakamurella multipartita
Pathway
nml00040  Pentose and glucuronate interconversions
nml00052  Galactose metabolism
nml00500  Starch and sucrose metabolism
nml00520  Amino sugar and nucleotide sugar metabolism
nml01100  Metabolic pathways
nml01130  Biosynthesis of antibiotics
Module
nml_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Namu_1767
   00052 Galactose metabolism
    Namu_1767
   00500 Starch and sucrose metabolism
    Namu_1767
   00520 Amino sugar and nucleotide sugar metabolism
    Namu_1767
Enzymes [BR:nml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Namu_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-ProteinID: ACV78157
UniProt: C8XGH4
Position
complement(1935071..1936453)
Genome map
AA seq 460 aa AA seqDB search
MVVDGLEQSRALMQKAGVGSAAIAAFAHSYRQLARGETGLLREDDLEPVIDLPRLDDLDI
DPELARTALAATVVVKLNGGLGTSMGMDRAKSLLPVRPDRTFLDIIAEQVLELRHRFAVP
LPITFMNSFRTSADTMRALARYPDLAVDGIPLEFRQNREPKLRADDLTPVHWPADPDLEW
CPPGHGDIYTALYGSGLLHLLLDQGFRYLFVSNADNLGARPDPRLAAWFAGSGAPYAAEL
SRKTDADRKGGQLVRRRSDGQLIQRETAQTRPEDLAVSLDATRHPFFHTNNLWMDLRALD
QTLRRSDGVMGLPIIRNVKTVDPTDPTSPEVIQIETAMGAAVGVFPGAVAIEVPRDRFLP
VKTTSDLLVLRSDAYRITEDIELRLAESRTSAPLVDLDPAYKLVGDFDRLFPHGAPSLVS
CDRLAVHGAWTFGRDVIVRGSVTVPADHAPGTIADGTILQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcgacggcctcgagcagtcgcgcgcgctgatgcaaaaggccggcgtcggctcg
gccgcgatcgccgcgttcgcccattcctaccggcaactggcccgaggggagaccggcctg
ctccgggaggacgatctcgagccggtcatcgacctgccgcgactcgacgacctggacatc
gacccggagctggctcgaactgccctggcggcgaccgtggtggtcaagctcaacggcggc
ctgggcacctcgatgggcatggaccgagcaaagtccttgctcccggtccgaccggaccgc
accttcctggacatcatcgccgagcaggtgctcgagctgcgccatcggttcgcggtgccg
ttgccgatcacgttcatgaacagcttccggacatcggccgacaccatgcgggcactggcc
cggtacccggacctggccgtcgacggaattccgttggagttccggcagaaccgtgaaccc
aagctgcgggcggacgacttgaccccggtgcactggccggccgacccggacctggagtgg
tgcccgcccgggcacggcgacatctacaccgccctgtacgggagcggactgctgcacctg
ctgttggaccaggggttccgatacctgttcgtatccaacgcggacaacctgggcgcccgc
ccggacccgcggttggcggcctggttcgccgggtccggtgcgccgtacgccgccgagctg
agtcgcaagaccgacgccgaccgtaagggtggccagctggtgcggcgccggtccgacggc
cagctgatccagcgggaaaccgcgcagacccgaccggaagaccttgcggtctcgctcgac
gcgacccgacacccgttcttccacaccaacaacctgtggatggacctgcgcgcactcgac
cagaccctccgtcgcagcgacggggtcatgggactgccgatcatccgcaacgtcaagacc
gtcgatccgaccgaccccacctcgcccgaggtcatccagatcgagaccgcgatgggcgcc
gccgtgggcgtcttccccggcgcggtggccatcgaagtgccacgggaccggttcctgccc
gtcaagaccaccagcgacctgctggtgctccgctcggacgcctaccggatcaccgaggac
atcgaactccggttggccgaaagccgaacgagcgcacccttggtcgacctggatccggcc
tacaagctggtcggcgacttcgaccggctgttcccgcacggggccccgtcactggtctcc
tgcgatcggctcgccgtgcacggcgcctggaccttcggccgggacgtcatcgtccgagga
tcggtcaccgtgcccgccgaccacgccccgggcacgattgccgacggcacgatcctgcag
tga

DBGET integrated database retrieval system