KEGG   Nakamurella multipartita: Namu_1771Help
Entry
Namu_1771         CDS       T00991                                 

Definition
glycoside hydrolase family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
nml  Nakamurella multipartita
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nml00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nml00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1940433..1942676)
Genome map
AA seq 747 aa AA seqDB search
MTSPATTSTVNEAARPADLGLNHPGSAVRHLRAAGVSVVIDCRGPRLPRIVHWGADLGDL
DRTTLDNLVRADVQAVVSNVPDQPISPGLLAEHSTGWLGLPGLLGHRAGHQWSTLFDVTT
VSSSNDRDGTRRVVVDAADPDAGLRLVLTLELLPAGVLRTRATLTSIADQAGAPYTVDGL
ALSLPVPTRATELLDFTGRHLRERHPQRRRFDVGSWVRDNRRGRTGADATMLLAAGTPGF
GFGHGEVWSVHTAWSGNHRTIAERSPNGHAVLSGGELLLPGEITLGPSESYTTPWIYGSY
GGAGLNAVADRFHAFLRGRPQHPRSPRPVILNTWESVYFDMDLPTLIALAEAGAEVGVER
YVLDDGWFTGRRDDTAGLGDWQVDRDVWPNGLKPLVDRVTKLGMQFGIWIEPEMINPDSN
LARAHPEWMLSTGHRLPIESRHQQVLDLANPGAFDYILGSLDDLLKKHDISYLKWDHNRD
LIDAGHSPDGQPAVHDQTLAVYRLIDELRRRHPGVEIESCSSGGARVDLEVLQRTDRVWT
SDCIDALERQTIQRYTGLLVPPEMLGAHIGTGQAHTTGRRHNLSFRAGTALFGHMGIEAN
LTSMSAAERAELGEWVALHKKLRPLLHTGRVVRFDDVDPSLMVQGVYAADLSQAVISIAA
IATADSAPIGRLVIPGLDPDAPYHLELLPPGDVIQGEDAERRNGNNKHLPPWLVTGTDLT
GAALTYAGVQLPDLLPEQLLLLRVTRV
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacccgccacgacttccaccgtcaatgaggccgcgaggccggccgacctcgga
ttgaaccaccccggttcggcggtccggcacctgcgagccgccggggtcagcgtggtgatc
gactgccgcgggccgcgtctaccgcgcatcgtgcactggggcgccgacctgggcgatctc
gaccggaccacgctggacaacctggttcgagccgatgtgcaggccgtggtcagcaatgtt
cccgaccaaccgatcagccctggactgctcgccgaacactcgaccggctggttgggactg
cccggcctgctcggacaccgtgccggccatcagtggtcgaccctgttcgacgtgacgacc
gtcagctcgagcaacgaccgggacggaacccgacgcgtcgtcgtcgacgcagcggatccg
gacgccggcctgcgcctcgtgctgaccctggagctgttgccggccggggtgcttcgcacc
cgagccaccctgacgtcgatcgccgaccaggccggcgcgccctacaccgtcgacgggctg
gccctgtcgcttccggtcccgacccgtgccaccgaactgctcgatttcaccggccggcac
ctgcgggaacggcatccgcagcgccgccggttcgatgtcggcagttgggtccgcgacaac
cgccgcggccgcaccggagccgacgccacgatgctgttggccgctggcacgcccggtttc
ggcttcggccacggtgaggtctggtcggtgcacaccgcctggagcggcaatcaccgcacg
atcgccgagcgcagtccgaacggacacgccgtgctgtccggcggggaactgttgctgcct
ggcgagatcaccctggggccgagcgagtcgtacaccacgccatggatctacggttcctac
ggcggtgccggcctgaacgccgtggccgaccgcttccacgccttcctgcgggggcggccg
cagcatccccgcagcccgcgtccggtcatcctgaacacctgggaatcggtgtacttcgac
atggacttgccgacgctgatcgcgctggccgaggccggcgccgaggtgggtgtcgaacgg
tacgtgctggacgatggctggttcaccggccgccgcgacgacaccgccgggctgggcgac
tggcaggtcgaccgcgacgtctggcccaatggcctcaagcccttggtggatcgggtcacc
aagctcggcatgcagttcggcatctggattgaacccgagatgatcaatcccgactccaat
ctcgcccgcgcgcacccggaatggatgctgtccaccgggcaccggctgcccatcgaatca
cggcaccagcaggtgctggatctggccaatccgggcgcgttcgactacatcctgggcagc
ctggacgacctgctcaagaagcacgacatcagttacctcaagtgggaccacaaccgggat
ctgatcgacgccgggcacagtccggacggtcagccggccgtgcacgaccagaccctggcc
gtgtaccggctgattgacgaactgcgccgccgccaccccggggtcgagatcgagtcatgc
tcctccggcggcgcccgagtcgatctggaggtgctgcagcgcaccgatcgggtttggacc
agcgactgcatcgacgccctggaacggcagacgatccagcgctacaccgggctgctggtg
ccgccggagatgctcggcgcccacatcggcaccggccaggcgcacaccaccggacgccgg
cacaacctgtccttccgggccggcaccgccctgttcggccacatgggaatcgaggccaac
ctgaccagcatgtcggccgccgagcgagctgaactgggcgaatgggttgccctgcacaag
aagctgcggccgctcctgcacaccggccgggtggtccgtttcgacgacgtcgacccctcg
ctgatggtgcagggtgtctacgcggccgacctttcccaagccgtgatcagcatcgccgcg
atcgcgaccgccgacagcgccccgatcggccggctcgtcattcccggcctggatccggac
gcgccctatcacctggagctgctgccgcccggcgatgtcatccagggcgaggacgccgag
cgccgcaacggcaacaacaagcacctgccaccgtggctcgtcaccgggaccgacctgacc
ggcgcggcgctgacctacgccggggtgcagctgcccgatctgcttcccgagcagctgctg
ctgctgcgcgtcacccgggtatga

DBGET integrated database retrieval system