KEGG   Nakamurella multipartita: Namu_1771Help
Entry
Namu_1771         CDS       T00991                                 

Definition
glycoside hydrolase family protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
nml  Nakamurella multipartita
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Namu_1771
  Lipid metabolism
   00561 Glycerolipid metabolism
    Namu_1771
   00600 Sphingolipid metabolism
    Namu_1771
Enzymes [BR:nml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Namu_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1940433..1942676)
Genome map
AA seq 747 aa AA seqDB search
MTSPATTSTVNEAARPADLGLNHPGSAVRHLRAAGVSVVIDCRGPRLPRIVHWGADLGDL
DRTTLDNLVRADVQAVVSNVPDQPISPGLLAEHSTGWLGLPGLLGHRAGHQWSTLFDVTT
VSSSNDRDGTRRVVVDAADPDAGLRLVLTLELLPAGVLRTRATLTSIADQAGAPYTVDGL
ALSLPVPTRATELLDFTGRHLRERHPQRRRFDVGSWVRDNRRGRTGADATMLLAAGTPGF
GFGHGEVWSVHTAWSGNHRTIAERSPNGHAVLSGGELLLPGEITLGPSESYTTPWIYGSY
GGAGLNAVADRFHAFLRGRPQHPRSPRPVILNTWESVYFDMDLPTLIALAEAGAEVGVER
YVLDDGWFTGRRDDTAGLGDWQVDRDVWPNGLKPLVDRVTKLGMQFGIWIEPEMINPDSN
LARAHPEWMLSTGHRLPIESRHQQVLDLANPGAFDYILGSLDDLLKKHDISYLKWDHNRD
LIDAGHSPDGQPAVHDQTLAVYRLIDELRRRHPGVEIESCSSGGARVDLEVLQRTDRVWT
SDCIDALERQTIQRYTGLLVPPEMLGAHIGTGQAHTTGRRHNLSFRAGTALFGHMGIEAN
LTSMSAAERAELGEWVALHKKLRPLLHTGRVVRFDDVDPSLMVQGVYAADLSQAVISIAA
IATADSAPIGRLVIPGLDPDAPYHLELLPPGDVIQGEDAERRNGNNKHLPPWLVTGTDLT
GAALTYAGVQLPDLLPEQLLLLRVTRV
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacccgccacgacttccaccgtcaatgaggccgcgaggccggccgacctcgga
ttgaaccaccccggttcggcggtccggcacctgcgagccgccggggtcagcgtggtgatc
gactgccgcgggccgcgtctaccgcgcatcgtgcactggggcgccgacctgggcgatctc
gaccggaccacgctggacaacctggttcgagccgatgtgcaggccgtggtcagcaatgtt
cccgaccaaccgatcagccctggactgctcgccgaacactcgaccggctggttgggactg
cccggcctgctcggacaccgtgccggccatcagtggtcgaccctgttcgacgtgacgacc
gtcagctcgagcaacgaccgggacggaacccgacgcgtcgtcgtcgacgcagcggatccg
gacgccggcctgcgcctcgtgctgaccctggagctgttgccggccggggtgcttcgcacc
cgagccaccctgacgtcgatcgccgaccaggccggcgcgccctacaccgtcgacgggctg
gccctgtcgcttccggtcccgacccgtgccaccgaactgctcgatttcaccggccggcac
ctgcgggaacggcatccgcagcgccgccggttcgatgtcggcagttgggtccgcgacaac
cgccgcggccgcaccggagccgacgccacgatgctgttggccgctggcacgcccggtttc
ggcttcggccacggtgaggtctggtcggtgcacaccgcctggagcggcaatcaccgcacg
atcgccgagcgcagtccgaacggacacgccgtgctgtccggcggggaactgttgctgcct
ggcgagatcaccctggggccgagcgagtcgtacaccacgccatggatctacggttcctac
ggcggtgccggcctgaacgccgtggccgaccgcttccacgccttcctgcgggggcggccg
cagcatccccgcagcccgcgtccggtcatcctgaacacctgggaatcggtgtacttcgac
atggacttgccgacgctgatcgcgctggccgaggccggcgccgaggtgggtgtcgaacgg
tacgtgctggacgatggctggttcaccggccgccgcgacgacaccgccgggctgggcgac
tggcaggtcgaccgcgacgtctggcccaatggcctcaagcccttggtggatcgggtcacc
aagctcggcatgcagttcggcatctggattgaacccgagatgatcaatcccgactccaat
ctcgcccgcgcgcacccggaatggatgctgtccaccgggcaccggctgcccatcgaatca
cggcaccagcaggtgctggatctggccaatccgggcgcgttcgactacatcctgggcagc
ctggacgacctgctcaagaagcacgacatcagttacctcaagtgggaccacaaccgggat
ctgatcgacgccgggcacagtccggacggtcagccggccgtgcacgaccagaccctggcc
gtgtaccggctgattgacgaactgcgccgccgccaccccggggtcgagatcgagtcatgc
tcctccggcggcgcccgagtcgatctggaggtgctgcagcgcaccgatcgggtttggacc
agcgactgcatcgacgccctggaacggcagacgatccagcgctacaccgggctgctggtg
ccgccggagatgctcggcgcccacatcggcaccggccaggcgcacaccaccggacgccgg
cacaacctgtccttccgggccggcaccgccctgttcggccacatgggaatcgaggccaac
ctgaccagcatgtcggccgccgagcgagctgaactgggcgaatgggttgccctgcacaag
aagctgcggccgctcctgcacaccggccgggtggtccgtttcgacgacgtcgacccctcg
ctgatggtgcagggtgtctacgcggccgacctttcccaagccgtgatcagcatcgccgcg
atcgcgaccgccgacagcgccccgatcggccggctcgtcattcccggcctggatccggac
gcgccctatcacctggagctgctgccgcccggcgatgtcatccagggcgaggacgccgag
cgccgcaacggcaacaacaagcacctgccaccgtggctcgtcaccgggaccgacctgacc
ggcgcggcgctgacctacgccggggtgcagctgcccgatctgcttcccgagcagctgctg
ctgctgcgcgtcacccgggtatga

DBGET integrated database retrieval system