KEGG   Nakamurella multipartita: Namu_1864Help
Entry
Namu_1864         CDS       T00991                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nml  Nakamurella multipartita
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Namu_1864
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Namu_1864
  Amino acid metabolism
   00310 Lysine degradation
    Namu_1864
Enzymes [BR:nml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Namu_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2047467..2049209)
Genome map
AA seq 580 aa AA seqDB search
MSHSVQMPALGESVTEGTVTRWLKNVGDQVEVDEPLLEVSTDKVDTEIPAPYSGVLEKIL
VAEDETADVGADLAIIGDGSGASAEPASAPAAEPEAAPAAQAAPAEAPSTEAEAPAEKPK
AATGSAAGGTSVKLPEMGESVTEGTVTRWLKAVGDEVAVDEPLVEVSTDKVDTEVPSPVA
GTLLEISVGEDETIEVGGQLGVIGDAAAAPAAAPEPEPAPKAEAKPEAPKPAAAAAPAAP
AAPAAPAKPVSALPPERVPEGTYVTPVIRKLAADAGVDLASVKGTGVGGRIRREDVVAAA
EAAKAQAAAPAPAAAPAAAAPAAAPAAGSSVPKPDEKASALIGTTVKLPRIRQSIAKNMK
HGLDTAAQLTTVFEVDCTRIAALRAKAKNSFAAREGVNLSFLPFFVKAALEALKAYPVIN
STLADDLKEITYHGSVNLGIAVDTPRGLIVPVIKGADDLNIAGLARKIGELAAKTRDNKV
GPDELSGGTFTITNTGSVGALFDTPIFVPPQSAILGTGAIVKRPVVAKDADGNEVIAIRS
MCYLALSYDHRNIDGADASRFLSAVKKRIEAGEFEGDLGL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtcccactccgttcagatgcccgcgctcggggagagcgtcaccgagggcaccgtcacc
cgatggctcaagaacgtgggcgaccaggtcgaggtcgacgagcccctgctggaggtctcg
accgacaaggtcgacaccgaaattcccgccccgtacagcggcgtgctggagaagatcctc
gtcgccgaggacgaaaccgctgatgtgggcgccgatctggcgatcatcggcgacggctcc
ggcgcgtcggccgagcccgccagcgccccggccgcggagccggaggcggccccggccgcc
caggccgcgcccgccgaggcgccctccaccgaggccgaggcccccgccgagaagccgaag
gcggccaccggcagcgccgccggcggcacgtcggtcaagctgcccgagatgggcgagtcg
gtcaccgagggcaccgtcacccgctggctcaaggcggtcggtgacgaggtcgcggtcgac
gagccgctggtcgaggtctccaccgacaaggtcgacaccgaggtcccgtcccccgtggcc
ggcaccctgctggagatcagcgtcggcgaggacgagacgatcgaggtcggcggccaactg
ggcgtcatcggtgacgccgccgccgctcccgcggcggcgcccgagcccgaaccggccccg
aaggccgaagccaagcccgaggccccgaagccggccgccgctgctgcacccgccgcgccc
gccgccccggccgctccggccaagcccgtctcggcgctgccgccggagcgggtgcccgag
ggcacctacgtcaccccggtgatccgcaagctcgccgcggacgccggcgtcgacctggcc
tcggtcaagggcaccggcgtgggcggtcgcatccgtcgcgaggacgtcgtggccgcggcc
gaggcggccaaggctcaggccgccgccccggctccggccgcggctcccgccgccgccgcg
ccggccgccgccccggcggccgggtccagcgtgcccaagccggacgagaaggccagcgcg
ctgatcggcacgacggtcaagctgccccggatccggcagtcgatcgccaagaacatgaag
cacggcctggacaccgcggcccagctgaccacggtgttcgaggtggactgcacccggatc
gccgcgctgcgggccaaggcgaagaactcgttcgccgcccgcgagggcgtcaacctgtcc
ttcctgccgttcttcgtcaaggcggcgctggaggccctcaaggcctacccggtgatcaac
tcgacgctggcggacgatctgaaggagatcacctaccacggctcggtcaacctgggcatc
gcggtggacactccgcggggcctgatcgtgccggtgatcaagggcgcggacgatctgaac
atcgccgggctggcccgcaagatcggcgagctggccgccaagacccgggacaacaaggtc
ggtccggacgagctgtccggcggcaccttcaccatcaccaacaccgggtcggtgggcgcg
ctgttcgacacgccgatcttcgtgccgccgcagtcggcgatcctgggcaccggggcgatc
gtcaagcgcccggtggtggcaaaggacgccgacggcaacgaggtcatcgccattcgctcg
atgtgctacctggcgctgtcctacgaccaccgcaacatcgacggggccgacgcctcccgg
ttcctgtccgcggtcaagaagcggatcgaggccggcgagttcgagggcgacctgggcctg
taa

DBGET integrated database retrieval system