KEGG   Nakamurella multipartita: Namu_2012Help
Entry
Namu_2012         CDS       T00991                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nml  Nakamurella multipartita
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Namu_2012
Enzymes [BR:nml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Namu_2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2221935..2222897
Genome map
AA seq 320 aa AA seqDB search
MIVVVGSLNADLVVTTERHPQPGETVRGGNLSVIPGGKSANQAVAASRLGGRVRLIGAVG
DDANGDLLRTAAAAAGVDVAGVQVRPGTVTGTAVITVDAAGENTIVISPGANALVNADQI
GARTFDGAAALVLCLEIPIDVVLTAARTAAAAGVTVVTNLSPYQRVPRELLTLTDVLLLN
DHEAQHLVGATGATSTSELRDALAAHHIQRAIVTRGVDGCLVFDGPAPVVHVPTVQVTAV
DTTGCGDAFTGALAFRLACGDTVVAAAQFATKVGAYAATKPGAQSSFPTAAELCQFLSGR
EPARQNSIPPGTTVGHGSGQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcgtggtcggctcgctcaacgccgacctggtcgtgaccaccgagcgccacccg
caaccgggggagacggtccggggcggcaacctttccgtcatccccgggggtaagagcgcc
aaccaggccgtcgcggccagccggctcggcggacgggtgaggttgatcggcgcggtcggt
gatgacgccaacggcgacctgctgcgtacggctgccgccgcggccggcgtcgatgtcgcc
ggcgtgcaggtccgtcccgggacggtcaccggaaccgccgtcatcaccgtcgatgccgcg
ggtgagaacaccatcgtcatctcgccaggagccaacgcattggtcaacgccgaccagatt
ggcgcccggacattcgacggggccgcagccctggtcctgtgcctggagatcccgatcgat
gtcgtcctgaccgcagcccgcactgccgccgcggcgggagtcacggtcgtcaccaatctc
tcgccctaccaacgggtgccgcgggaactgctgaccctgaccgatgtgctgctgctcaac
gaccacgaagcgcagcacctggtcggcgcgaccggtgccacctcgacttccgagctgcgc
gacgcgctggccgcacaccacattcagcgcgccatcgtcacccgcggcgttgatggctgc
cttgtcttcgacggtcccgcccctgtcgtccacgtccccaccgtgcaagtgacggccgtc
gacaccaccggatgcggcgacgccttcaccggagccctggcctttcgcctggcttgcggg
gacaccgtcgtcgccgccgctcaattcgcgaccaaggtcggcgcctacgcagccaccaaa
ccaggggcgcaaagctcgttccccactgctgccgaactgtgtcagttcctgtccggccgc
gagccggcgaggcagaactcgatccctccgggaacgacggtcggtcatggatcagggcaa
tga

DBGET integrated database retrieval system