KEGG   Nakamurella multipartita: Namu_2035Help
Entry
Namu_2035         CDS       T00991                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nml  Nakamurella multipartita
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nml00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:nml00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2244639..2246111
Genome map
AA seq 490 aa AA seqDB search
MRSRRGCGLPGSNRARLVGALAAGGLVLAACSSAPDPSAGSASGAAVSSSPVSSPVSSPA
LSAALSSAAPTPSSTEPTPSATAPASPSAPPPEAAAPAPAVPAGGLVTGADMTAASAAVA
AMSTADRAGLVVMASSADAVDTDLVAQLHLGGVILMGSQGSIDGTSTGTPEQVAAVTAQL
QSQVPAAQAGAPLLIATDQESGLVTRLVNGFNDFPGNQELSGIADTAAAAAATEAVTAAS
GAEMRAVGINVDFAPDADVLPQSGDSGVDGRTFGADPDRSATLVAAAVRGYQSGGVAATV
KHFPGIGRLATDTHKALPSLDVDCAEWNAVEAVPMQAGVDAGAALVMTGHIELPAVGAVG
ESSALSSAVVTDLLKGSGAGGCTGLNFAGVAVSDSFEMAPVVDNFSPSEAAWRGIAAGQD
LVLMPVDPTAAVTGIAAAADSGQLPATRLAEAATRVYALRLALGRIPAPGLEVVGSAEHE
AVAANARAQG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcccgacgcggctgcggtctgcccggttcgaaccgcgcccggctggtcggcgcg
ctggccgccggtggcctggtgctggccgcgtgctcgtccgcacccgacccgtccgccggt
tccgcctccggcgcggcggtgtccagcagcccggtgtccagccccgtgtccagcccggcg
ttgagtgctgcgttgagttcggcggcgccgaccccatcgagcaccgaaccgacaccgtcg
gccaccgcaccggccagtccgagtgccccgccgccggaggccgccgcgccggcgccggcc
gtcccggccggtgggttggtgaccggcgccgacatgacggccgcgtccgccgcggtggcc
gcgatgagcaccgccgaccgcgccggcctggtcgtcatggccagctcggccgacgccgtg
gacaccgatctggtcgcgcagctgcacctgggcggggtgatcctgatggggtcgcagggg
tcgatcgacggcacctcgaccggtacgcccgagcaggtcgccgcggtcaccgcccagctg
cagagtcaggtgccggccgcccaggcgggcgcgccgctgctgatcgccaccgaccaggaa
tccggcctggtcacccggctggtcaacggtttcaacgacttccccggcaaccaggaactg
tccggcatcgccgacaccgccgcggcggccgcggccactgaggcggtcaccgcggccagc
ggggccgagatgcgcgcggtcggcatcaacgtcgacttcgcgccggacgccgacgtgctg
ccgcagtccggggattccggggtcgacggccggaccttcggcgccgatcccgaccggtcg
gcgaccctggtcgccgccgccgtccgcgggtaccagagcggcggggtggccgcgacggtc
aagcacttcccggggatcggccggctggctaccgacacgcacaaggcgctgccgtcgctg
gacgtggactgcgcggagtggaacgcggtcgaggcggtgccgatgcaggccggagtggac
gccggcgccgcgctggtgatgaccggacacatcgaattgccggcggtcggcgcggtgggc
gagtcgtcggcgctgagctccgcggtggtcaccgacctgctcaagggctcgggggcgggc
ggctgcaccgggctgaacttcgccggcgtcgcggtctccgactcgttcgagatggcgccg
gtggtggacaacttctcgccgagcgaggccgcctggcggggcatcgcggccggtcaggac
ctggtgctgatgccggtcgacccgacggccgcggtgaccggcatcgccgccgcggccgac
agcgggcagctgccggcgacgcggctggccgaggcggccacccgggtctacgcgctgcgg
ctggcgctgggtcggatcccggcccccggcctggaggtggtcggctcggccgagcacgag
gcggtcgcggcgaacgcacgggcccagggctga

DBGET integrated database retrieval system