KEGG   Nakamurella multipartita: Namu_2096Help
Entry
Namu_2096         CDS       T00991                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nml  Nakamurella multipartita
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Namu_2096
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Namu_2096
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Namu_2096
Enzymes [BR:nml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Namu_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2313952..2315064
Genome map
AA seq 370 aa AA seqDB search
MDAPVSDASVTGIAGGAGAGWPGLIAAYADRVAVPPGARVVTLLEGGTPLLPAHTLSDRL
GVQVYLKVEGANPTGSFKDRGMTVAVTHALARGARAVICASTGNTSASAAAYAARAGLTS
AVLIPQGKIASGKLAQAVAYGARILQVEGNFDDCLELARKTAATTDEIELVNSVNPVRIE
GQKTAAFEICDVLGRAPDVHFLPVGNAGNITAYWKGYREYHADGVIDALPRMFGFQAAGA
APLVLGHPVRDPDTIATAIRIGAPASWSGAIGARDESGGLIDMVTDDQILDAYRLLASTE
GVFVEPASAASVAGLTATVADGRLPAGSLVVCTVTGNGLKDPDTAMSFMTEPVVLPVAAE
AVTDALGLTG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggatgcacccgtgtcggacgcgagcgtgaccgggatcgccggcggggccggggccggg
tggccggggctgatcgccgcctacgccgaccgggtcgccgtgccgcccggggcccgggtg
gtcacgttgctggagggcggcacgccgctgctgccggcgcacaccctgtccgaccggctg
ggcgtgcaggtctacctcaaggtcgagggggccaacccgaccggctcgttcaaggaccgg
gggatgacggtcgcggtcacccacgcgctggcccgcggtgcccgcgcggtgatctgcgcc
tccaccggcaacacctcggcctcggcggccgcctatgcggcccgggccggactgaccagc
gcggtgctgatcccgcagggcaagatcgccagcggcaagctggcccaggccgtggcctac
ggggcccggatcctgcaggtcgagggcaacttcgacgactgcctggagctggcccgcaag
accgcggccaccaccgacgagatcgagctggtgaactcggtcaacccggtgcggatcgaa
gggcagaagaccgccgcgttcgagatctgcgacgtgctgggccgggccccggacgtgcac
ttcctgccggtcggcaacgcgggcaacatcaccgcgtactggaaggggtaccgcgagtac
cacgcggacggcgtcatcgacgctctgccccggatgttcggcttccaggccgccggcgcc
gcgccgctggtgctgggccatccggtgcgcgacccggacaccatcgcgaccgcgatccgg
atcggcgccccggcgtcttggagcggggcgatcggcgcccgggacgagtccggcggtctg
atcgacatggtcaccgacgaccagatcctggacgcctaccggctgctcgcctcgaccgag
ggcgtcttcgtcgagcccgcgtcggccgcgtcggtggccgggctgaccgccaccgtcgcc
gacggccggttgccggccgggtcgctggtggtctgcaccgtcaccggcaacgggctcaag
gacccggacaccgcgatgtcgttcatgaccgaaccggtcgtcctgccggtcgcggccgag
gcggtcaccgacgccctggggctcaccggatga

DBGET integrated database retrieval system