KEGG   Nakamurella multipartita: Namu_2096Help
Entry
Namu_2096         CDS       T00991                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nml  Nakamurella multipartita
Pathway
nml00260  Glycine, serine and threonine metabolism
nml00750  Vitamin B6 metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01230  Biosynthesis of amino acids
Module
nml_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Namu_2096
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Namu_2096
Enzymes [BR:nml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Namu_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACV78474
UniProt: C8XIA5
Position
2313952..2315064
Genome map
AA seq 370 aa AA seqDB search
MDAPVSDASVTGIAGGAGAGWPGLIAAYADRVAVPPGARVVTLLEGGTPLLPAHTLSDRL
GVQVYLKVEGANPTGSFKDRGMTVAVTHALARGARAVICASTGNTSASAAAYAARAGLTS
AVLIPQGKIASGKLAQAVAYGARILQVEGNFDDCLELARKTAATTDEIELVNSVNPVRIE
GQKTAAFEICDVLGRAPDVHFLPVGNAGNITAYWKGYREYHADGVIDALPRMFGFQAAGA
APLVLGHPVRDPDTIATAIRIGAPASWSGAIGARDESGGLIDMVTDDQILDAYRLLASTE
GVFVEPASAASVAGLTATVADGRLPAGSLVVCTVTGNGLKDPDTAMSFMTEPVVLPVAAE
AVTDALGLTG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggatgcacccgtgtcggacgcgagcgtgaccgggatcgccggcggggccggggccggg
tggccggggctgatcgccgcctacgccgaccgggtcgccgtgccgcccggggcccgggtg
gtcacgttgctggagggcggcacgccgctgctgccggcgcacaccctgtccgaccggctg
ggcgtgcaggtctacctcaaggtcgagggggccaacccgaccggctcgttcaaggaccgg
gggatgacggtcgcggtcacccacgcgctggcccgcggtgcccgcgcggtgatctgcgcc
tccaccggcaacacctcggcctcggcggccgcctatgcggcccgggccggactgaccagc
gcggtgctgatcccgcagggcaagatcgccagcggcaagctggcccaggccgtggcctac
ggggcccggatcctgcaggtcgagggcaacttcgacgactgcctggagctggcccgcaag
accgcggccaccaccgacgagatcgagctggtgaactcggtcaacccggtgcggatcgaa
gggcagaagaccgccgcgttcgagatctgcgacgtgctgggccgggccccggacgtgcac
ttcctgccggtcggcaacgcgggcaacatcaccgcgtactggaaggggtaccgcgagtac
cacgcggacggcgtcatcgacgctctgccccggatgttcggcttccaggccgccggcgcc
gcgccgctggtgctgggccatccggtgcgcgacccggacaccatcgcgaccgcgatccgg
atcggcgccccggcgtcttggagcggggcgatcggcgcccgggacgagtccggcggtctg
atcgacatggtcaccgacgaccagatcctggacgcctaccggctgctcgcctcgaccgag
ggcgtcttcgtcgagcccgcgtcggccgcgtcggtggccgggctgaccgccaccgtcgcc
gacggccggttgccggccgggtcgctggtggtctgcaccgtcaccggcaacgggctcaag
gacccggacaccgcgatgtcgttcatgaccgaaccggtcgtcctgccggtcgcggccgag
gcggtcaccgacgccctggggctcaccggatga

DBGET integrated database retrieval system