KEGG   Nakamurella multipartita: Namu_2131Help
Entry
Namu_2131         CDS       T00991                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
nml  Nakamurella multipartita
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nml00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nml00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2349817..2351082
Genome map
AA seq 421 aa AA seqDB search
MERFLVTGGSRLSGTVRVAGAKNSVLKLMAAALLAEGTTEISNCPEILDVPLMADVLRGL
GAEVALAGDTVTITTPAELSFHADFPAVGRLRASVCVLGPLMGRCRRAQVALPGGDAIGS
RPLDMHQSGLRAMGASMSIEHGKVVGSAAELHGALIGLDFPSVGATENILMAAVLARGTT
VIDNAAREPEIIDLARLLQQMGAQIEGAGTATITIDGVDRLHPTSHRTVGDRVVGGTWAY
AAAITQGSVRVEGVDPAFLTAPLERLSSAGAQIETEPDAVRVTMAQRAKAVDFITMPYPG
FPTDLQPMALALAAVADGHSLITENVFEARFRFVDELIRMGADARTDGHHASLRGREQLS
SAPVWATDIRAGAGLVLAGLAADGVTEVHEVFHIDRGYPHFVEDMTALGGRIQRVDSADE
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgcttcctggtgaccggaggatcacgcctgtccggcacggtccgggtggccggg
gccaagaacagcgttctcaagctgatggccgcggcgctactggccgagggcacgaccgag
atctccaactgccccgagatcctggacgtgccgctgatggccgacgtgctgcgcgggctg
ggcgcggaggtggctctggccggggacacggtcaccatcaccacgccggccgaactgtcc
ttccacgccgatttcccggccgtcggccggttgcgggcctcggtctgcgtgctcggtccg
ttgatgggccgctgccggcgggcccaggtcgcgctgcccggaggcgacgcgatcggctcg
cgtccgctggacatgcaccagtccggtctgcgggccatgggcgcctcgatgagcatcgag
cacggcaaggtggtcggttccgccgccgaactgcacggcgccctgatcggtctggacttc
cccagtgtcggcgcgaccgagaacatcctgatggccgccgtgctggcccgggggaccacg
gtgatcgacaacgccgcccgggagccggagatcatcgacctggcccgcctgctgcagcag
atgggggcccagatcgagggcgccgggaccgcgacgatcaccatcgacggggtcgaccgg
ctgcacccgacgagtcaccgcaccgttggtgaccgggtggtgggcgggacctgggcgtac
gccgccgcaatcacccagggctcggtccgggtcgagggggtcgacccggcgttcctgacc
gcaccgttggaacggttgagcagcgccggtgcccagatcgagaccgagccggacgccgtc
cgggtcaccatggcccagcgggccaaggcggtcgacttcatcaccatgccctaccccggt
ttcccgaccgatctgcaaccgatggcgctggccctggccgcggtcgccgacggacattcg
ttgatcaccgagaacgtcttcgaggcccgtttccgcttcgtcgacgagctgatccggatg
ggcgccgacgcccggaccgacggccaccatgcctcgctgcgggggcgcgagcagctttcc
agtgccccggtctgggcgaccgacatccgcgccggcgccggcctggtgctggccgggctg
gccgcggacggagtcaccgaggtgcacgaggtcttccacatcgaccggggctacccgcat
ttcgtcgaggacatgaccgcgctgggtggccggatccaacgagtcgattccgccgacgag
tcctga

DBGET integrated database retrieval system