KEGG   Nakamurella multipartita: Namu_2282Help
Entry
Namu_2282         CDS       T00991                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nml  Nakamurella multipartita
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nml00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2516583..2517842
Genome map
AA seq 419 aa AA seqDB search
MSPSVRRVPVPDVDSHGSDRHPSDRDGDDRDGDNRDREDVAGVTGQTVTGSVVGFDPDEL
VGFRIGVTAHRRSADLIAALERRGAEVLHAPTLRIVPADQDERLIVATAEVIAARPDILL
VTTAYGLRGWLEAADAAGLGPSLLEVLSEAKILVRGPKARGAVRAGGLRDAGMSDEETTE
SLIDQVLANGADGLTVAIQLHGFVDEEQLVRLRQAGATVITVAPYLWTAPSEPQRVQRLL
DAIAGRSLDAVTFTSAPAAEALLAAARERDRFDQVVAAMRADVVPFVVGPVTAAPLHAVG
IDAIYPDRYRLGAMVRTLCEYLIEHHVRRVPTRHGLLEIRGRSAALDGQRVTLSPTSVAA
LRLLADAAGAVVPKARLQEVLPDSGDDHALEVAIARLRQALPQRDLVATVIKRGYRLDV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgagcgtccggcgggtccccgtgcccgacgtagactcccacgggagcgatcga
cacccgagcgatcgagacggtgacgatcgagacggtgataatcgagaccgcgaagacgtg
gcgggggtgaccggacagaccgtgactggatccgtggtcggtttcgatcccgacgagctc
gtcggcttccggatcggggtgaccgcgcaccgccgttcggccgacctgatcgccgccctg
gaacgtcgtggggccgaagtgctgcacgcgccaaccctgcggatcgtgccggccgatcag
gacgagcggctcatcgtcgcgaccgccgaggtgatcgccgcccggccggacatcctgctg
gtcaccaccgcctatggtctgcgcggctggctcgaggccgccgatgcggccgggctcggc
ccgtcgttgctcgaagtgctcagcgaagcaaagattctcgtgcgcggtccgaaggcccgg
ggcgcggtccgggccggcggcctgcgggacgcggggatgagcgacgaggaaaccaccgag
tcgctgatcgaccaggtgctggccaacggggcggacgggctcacggtggcgatccagctg
cacgggttcgtcgacgaggaacagctggtgcggctgcgccaggccggggccacggtgatc
accgtggcgccctacctgtggaccgcgccgtccgagccgcaacgggtgcagcgcctgctc
gacgcgatcgccggccgctccctggacgccgtcaccttcaccagcgccccggccgccgag
gcgctgctggccgcggcccgcgaacgggaccggttcgaccaggtcgtcgcggcgatgcgg
gccgatgtggtgccgttcgtcgtcggcccggtcaccgccgccccgttgcacgccgtgggc
atcgacgccatctacccggaccgctaccggctcggggccatggtccgaaccctgtgcgag
tacctcatcgagcaccatgtccgccgggtgccgacccggcacgggctgctggagatccgc
ggccgcagcgccgccctggacggccagcgggtcacgctgtcgccgacgtcggtcgccgcg
ctgcgcctgctggcggacgccgccggggcggtggtgcccaaggcccgcctgcaggaggtg
ctgcccgactccggggacgatcacgccctcgaggtggcgatcgcccggctacggcaggcg
ctgccgcagcgcgacctggtggccaccgtgatcaagcgcgggtaccggctggacgtgtga

DBGET integrated database retrieval system