KEGG   Nakamurella multipartita: Namu_2318Help
Entry
Namu_2318         CDS       T00991                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nml  Nakamurella multipartita
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Namu_2318
  Amino acid metabolism
   00300 Lysine biosynthesis
    Namu_2318
Enzymes [BR:nml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Namu_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2560608..2561957
Genome map
AA seq 449 aa AA seqDB search
MNGPDEFDPLAVVELAARLVRLRTVHDGRAGGDQGGDHGGNHGGNHGGTHGGDVERPAVE
LVAALMRDFGWSVSVVEVAAGRHSAIGVIDGAIEGAGPGRTLMFEGHVDVVTEGDPDSWS
FEPYVGDIVPGPGAEQELILRGRGSADMKAGVAAMLHAARAVELGGFTGRIVVGVLAGEE
GMMLGAKRFAADLVAGAIPGVGTVDGVIVCEPEGGEVCPVAKGALRLAVRFTGAMAHGAM
PWMGRNPLPAIGSMLAAIADTERVLRATYGEHPLLGPICLTPTVLRAGELDQINVMPAHA
TLAIDVRTTPQVEHARLVADLADTASRIARASGLTAELTVIDDRPPVNTSPDHPVVQAML
AGHLAATGRPAVIGGVPGATDGTILTRDAGLATVVYGPGGKWIAHQADEHVAVADIITST
RAYIAAARHFLRGAPDGGEPLDTTDSGGH
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgggcccgacgagttcgaccccctggcggtggtcgagctggccgcccggctggtc
cggctgcgcaccgtgcacgacggccgggccggcggggatcagggcggcgatcacggtggg
aatcacggggggaatcacggtgggactcacggtggggacgtggaacggccggcggtcgag
ctggtggccgccctcatgcgcgacttcggctggtcggtcagtgtcgtcgaggtcgctgcg
ggccggcactcggcgatcggcgtgatcgacggggcgatcgagggagccgggcccgggcgg
accctgatgttcgagggccacgtcgacgtggtgaccgagggcgacccggacagctggtcg
ttcgaaccctacgtcggggacatcgtccccgggccgggcgcagagcaggagctgatcctg
cgcggccgggggagcgcggacatgaaggccggggtggccgccatgctgcacgccgcccgg
gcggtcgagctcggcgggttcaccggtcggatcgtcgtcggggtgctggccggcgaagaa
ggaatgatgctgggcgccaagcgtttcgccgccgatctggtcgccggtgcgatccccggg
gtgggcaccgtggacggggtgatcgtctgcgagcccgagggtggcgaggtctgcccggtg
gccaagggggcattacggctcgcggtgcgcttcaccggcgccatggcgcacggggcgatg
ccttggatgggccgaaacccgttgccggccatcgggtccatgctggccgcgatcgccgac
acggaacgggtgctgcgggccacgtacggcgagcacccgctgctgggtccgatctgcctg
accccgaccgtgctgcgggcgggcgagctcgaccagatcaacgtgatgccggcgcacgcc
accctggccatcgacgtgcgcaccacgccgcaggtcgagcacgcccggctggtggccgac
ctggccgacaccgcgagccggatcgcccgagcgagcgggctgaccgccgagctcaccgtc
atcgacgaccggccaccggtgaacacctcgccggatcatccggtggtgcaggcgatgctg
gccgggcacctggccgccaccggccggccggccgtgatcgggggtgtccccggcgccacc
gacggcaccatcctgacccgcgacgccggactggccaccgtggtctacggccccggcggg
aaatggatcgcccatcaggccgacgagcacgtcgccgtcgcggacatcatcaccagcacc
cgggcctacatcgcggcggcccggcacttcttgcgcggtgcgccggacggcggcgaaccg
ttggacacgacggactccggaggccactga

DBGET integrated database retrieval system