KEGG   Nakamurella multipartita: Namu_2802Help
Entry
Namu_2802         CDS       T00991                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nml  Nakamurella multipartita
Pathway
nml00010  Glycolysis / Gluconeogenesis
nml00051  Fructose and mannose metabolism
nml00562  Inositol phosphate metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01200  Carbon metabolism
nml01230  Biosynthesis of amino acids
Module
nml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nml_M00002  Glycolysis, core module involving three-carbon compounds
nml_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_2802
   00051 Fructose and mannose metabolism
    Namu_2802
   00562 Inositol phosphate metabolism
    Namu_2802
Enzymes [BR:nml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Namu_2802
Exosome [BR:nml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Namu_2802
  Exosomal proteins of bladder cancer cells
   Namu_2802
  Exosomal proteins of melanoma cells
   Namu_2802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: ACV79147
UniProt: C8X9I9
Position
3074106..3074891
Genome map
AA seq 261 aa AA seqDB search
MATRTPLIAGNWKMNLTHLEGIALVQKISFTLPEKYLKHVEVAVFPPFTALRSVQTLIEA
DKIDFKYGAQDVSAHDSGAYTGEISGIQLSKLGCTYVLVGHSERREYHHETDEQLAKKVN
AAYKHGLIPMLCVGEGLEIREAGNQVAYSVNQLLAGIADVTPEQAESLVLAYEPVWAIGT
GRVATPADAQEVCAALRVALAGKYGQETADKIRILYGGSVKSGNVAEICAQTDVDGALVG
GASLDGTEFATLAANAVGVLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctacccgtaccccgctcatcgccggcaactggaagatgaacctgactcatctggag
ggcatcgccctggtccagaagatctcgttcaccctgccggagaagtacctcaagcacgtc
gaggtggcggtcttcccgccgttcaccgcgctgcgctcggtgcagaccctgatcgaggcc
gacaagatcgacttcaagtacggcgcccaggacgtctcggcgcacgactcgggcgcctac
accggcgagatctccggcatccagctgtccaagctcggctgcacctatgtgctggtcggg
cactcggagcggcgtgagtaccaccacgagaccgacgagcaactggccaagaaggtcaac
gccgcctacaagcacgggctgatcccgatgttgtgcgtcggcgagggcctggagatccgg
gaagccggcaaccaggtcgcgtactcggtcaaccagctgctggccgggattgccgacgtc
acccctgagcaggccgaatccctcgtgctggcctacgagccggtgtgggccatcggcacc
ggccgggtggccaccccggccgacgcccaggaggtctgtgccgcgctgcgggtcgcgctg
gccggcaagtacgggcaggagaccgcggacaagatccgcatcctgtacggcggatcggtc
aagtccggcaacgtcgcggagatctgcgcgcagaccgacgtggacggtgccctggtcggc
ggcgcgtcgctggacgggaccgaattcgccacgctggccgcgaacgcggtcggggtcctg
ccctga

DBGET integrated database retrieval system