KEGG   Nakamurella multipartita: Namu_2922Help
Entry
Namu_2922         CDS       T00991                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
nml  Nakamurella multipartita
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Namu_2922
Enzymes [BR:nml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Namu_2922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3195566..3197299
Genome map
AA seq 577 aa AA seqDB search
MTADDYDVVVIGSGFGGAVSALRLAEKGYRVGVLEAGQRFTETSLPATSWDIRRFLWAPR
LGCYGIQRINLLKDVVVLGGAGVGGGSLNYANTLYEPLAAFFQDRQWAHITDWQAELAPH
YDQARRMLGVTQNREVSAADVVIKEVAADMGVGDSFRLTPVGVFFGEPGMRKGAAVRDPF
FGGAGPDRRTCIGCGSCMTGCRHNAKNTLDKNYLYLAEKMGAQIIPLTTVTDVRPRREGG
YEVRSVRTGTSARWRRNRRTDTAGQVIFAAGTYHTQKLLHRLRDTGTLPRISARLGELTR
TNSESILGAKSFRKDADYTQGVAITSSFHPDEHTHIEPVRYGKGSNAMGLLATALTDGDT
GRPRWISWLTAFGTDPRNLTWFSPRHWSERTIILLVMQTLDNSITVSGRRTALGRYTLTS
AAGHGAPNPTWIPAAHDATRRVAGKIDGIAGGSVGDIANIPMTAHFLGGCVIGDSAETGV
IDPYHRLYGHPGLHVIDGSTVSANLGVNPSLTIAAQAERAIALWPNKDEPDPRPAIGAPY
RRLDPVTPRSPAVPAGAPAALRDPRAGAGAGYSSAQF
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgacgactacgacgtcgtggtcatcggatccggcttcggcggcgccgtcagt
gccctgcgactggccgaaaagggttaccgcgtcggtgttctggaggccggccagcgattc
accgagacgagcctgccggccacctcgtgggacatccggcggttcctgtgggccccccgg
ctcggctgctacggcattcaacggatcaatctgctcaaggacgtggtcgttctcggcggt
gccggagtcggcggcggctccctgaactacgccaacaccctgtacgaaccactcgcggcg
ttcttccaggaccggcagtgggcgcacatcacggactggcaggccgaactcgccccgcac
tacgaccaggcccgacgaatgctcggcgtgacccagaaccgcgaggtcagcgcggccgat
gtggtcatcaaggaggtcgccgcggacatgggggtcggcgattcgttccggctgaccccg
gtcggggtgttcttcggggagccgggcatgcgcaagggagccgcggtccgcgacccgttc
ttcggcggcgccggacccgaccgccgcacgtgcatcggctgcgggtcctgcatgaccggg
tgccggcacaacgccaagaacaccctggacaagaactacctgtacctggccgagaagatg
ggggcgcagatcatcccgttgaccacggtgaccgacgtccgcccgcgacgcgagggcggc
tacgaggtcaggtccgttcgaaccgggacgtcggcgcggtggcggaggaaccggcggacc
gacacggccggtcaggtgatcttcgccgccggcacgtaccacacccagaagctgctgcac
cggctgcgcgacacgggcacgctgccccggatctcagcccgcctgggcgagctgaccagg
accaactccgagtcgatcctgggggccaagtccttccgcaaggacgccgactacacccag
ggcgtggccatcacctcctcgttccaccccgacgagcacacccacatcgaaccggtgcgg
tacggcaagggcagcaacgcgatgggcttgctggccaccgcgttgaccgacggcgacacc
gggcgcccccggtggatcagctggctgacggcattcggcaccgatccgcggaatctgacc
tggttctcaccgcggcactggtccgagcgcaccatcatcctgttggtgatgcagaccctg
gacaactcgatcaccgtgtccggccggcgcaccgccctgggccggtacacgctcacctcc
gctgcggggcacggagcgcccaacccgacgtggatcccggcggcgcacgacgcgacccgc
cgggtggccggcaagatcgacggcatcgccggcggatcggtgggcgacatcgcgaacatt
ccgatgaccgcccatttcctgggcgggtgcgtcatcggtgactcggccgagaccggggtg
atcgacccctatcaccggctctacggccaccccggcctgcatgtgatcgacgggtcgacg
gtgtcggccaacctcggcgtgaacccgtcgctgaccatcgccgcgcaggccgaacgggcc
atcgcgctctggcccaacaaggatgagccggacccccggccggcgatcggtgccccctac
cgacggctcgacccggtgacgccccggtccccggccgtcccggccggcgcccccgcggcc
ttgcgggatccgcgggccggagccggcgctgggtacagttccgcccagttctga

DBGET integrated database retrieval system