KEGG   Nakamurella multipartita: Namu_2930Help
Entry
Namu_2930         CDS       T00991                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
nml  Nakamurella multipartita
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Namu_2930
Enzymes [BR:nml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Namu_2930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3205627..3206259
Genome map
AA seq 210 aa AA seqDB search
MTGPGVVRFFYGPMDCGKSTLALQIHENQVRQGRRGVLMTRLDRSGPARISSRIGLSSPA
IELTDELDLVATITAGGAVDYVVVDEAQFLTPAQVDQLGVVADEYGAHVFAFGIATDFRS
ILFAGSARLFEIADQVSPVQVEVLCWCGRTARFNGRVVDEQLARQGPTVLVADTEPDPAA
GDGRARYQVLCRRHYRSGQLAPNPTAPADV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggccccggcgtcgtccggttcttctacggcccgatggactgcggcaagtcgacc
ctggccctgcagatccacgagaaccaggtccggcagggccgtcgcggggtgctgatgacc
cgtctcgaccggtccgggccggcccggatcagctcccggatcgggctgagcagcccggcg
atcgagctgaccgacgagctggacctggtggccacgatcaccgccggcggcgcggtggac
tacgtggtggtggacgaggcccagttcctgaccccggcccaggtcgatcagctgggcgtg
gtcgctgacgagtacggcgcgcacgtgttcgcgttcggcatcgccaccgacttccgcagc
atcctgttcgccggctcggcccggttgttcgagatcgccgaccaggtcagcccggtgcag
gtcgaggtgctgtgctggtgcggccggacggcccggttcaacggccgggtggtcgacgag
cagttggcccggcagggtccgaccgtgctggtcgcggacaccgaaccggacccggcggcg
ggcgatggccgggcccggtaccaggtgctgtgccggcgccactatcgttcgggtcagttg
gccccgaaccccacggcgcccgcggacgtgtga

DBGET integrated database retrieval system