KEGG   Nakamurella multipartita: Namu_2950Help
Entry
Namu_2950         CDS       T00991                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nml  Nakamurella multipartita
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nml00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3231306..3232280
Genome map
AA seq 324 aa AA seqDB search
MNHPHTVSASGMVGPVDATRVPRYAGPATFARLPRLDEVSRADVAILGVPFDTGVSYRPG
ARFGPGHIRQSSKLLRPYHPGQDVHPFGVQQVADAGDVAVNPFDLTEAVQQIDDAVTAVR
ADGASLLTLGGDHTIALPILRSLYRDHGPIAVLHFDAHLDTWDTYFGAPYTHGTPFRRAS
EEGLLDLERCQHMGIRGPLYAATDLEDDAALGFQIVRADDYETDGVAGAVDRMRRRLGDG
PVYVSIDIDVLDPAHAPGTGTPEAGGLTSRELLHTLRGLTGLNVVGADIVEVAPAYDHAE
ITGIAAAHVAYELLAVLAKNRIAA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacccgcacaccgtctccgcctcgggcatggtcggcccggtcgacgccacccgg
gtcccccggtacgccggcccggcgaccttcgcccggctcccccgcctggacgaggtctcc
cgcgccgacgtcgccatcctgggcgtcccgttcgacaccggggtgagctaccgccccggc
gcccggttcggccccggccacatccggcagtccagcaagttgctgcgcccgtaccacccc
ggtcaggacgtgcaccccttcggcgtccagcaggtcgccgacgccggggacgtcgcggtc
aatccgttcgacctgaccgaggcggtgcagcagatcgacgacgcggtgaccgcggtccgc
gccgacggggcctcactgctcaccctgggcggcgaccacaccatcgcgctgccgatcctg
cgctcgctgtaccgggatcacgggccgatcgcggtgctgcacttcgacgcccacctggac
acctgggacacctacttcggcgcgccatacacccacggcaccccgttccgccgggcgtcc
gaggaaggcctgctggacctggaacgctgccagcacatgggcatccggggaccgctgtac
gcggccaccgatctggaggacgatgccgcgctgggcttccagatcgtccgcgccgacgac
tacgagaccgacggtgtggccggggcggtcgaccgaatgcggcgacggctcggtgacggc
ccggtctacgtctcgatcgacatcgacgtgctcgacccggcccacgccccgggcaccggc
accccggaggcgggtgggctgaccagccgcgagctgctgcacacactgcgcgggctgacc
ggcctgaacgtggtcggcgccgacatcgtcgaggtcgcgccggcctacgaccacgccgag
atcaccggcatcgccgccgcgcacgtggcctacgagctgctggccgtgctggccaagaac
cggatcgcggcatga

DBGET integrated database retrieval system