KEGG   Nakamurella multipartita: Namu_3074Help
Entry
Namu_3074         CDS       T00991                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nml  Nakamurella multipartita
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Namu_3074
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Namu_3074
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Namu_3074
Enzymes [BR:nml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Namu_3074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3390474..3391382)
Genome map
AA seq 302 aa AA seqDB search
MTSQPTSQPPSQPTVLAELFAGLRAQNRAALVGYLPAGYPDLAASKDLYAAIIEGGCDLV
EVGLPFSDPVLDGPVIQHAAQQALAGGFRVRDTFEIVESITARGGRAVVMTYFNPVLAYG
VDAFARDLAAAGGAGVITPDLIVDEAGPWLDAVHAHGIDPIFLVAPSSSAERIALTAASG
GGFVYAASVMGVTGARDQVSSAAPDLVARCRTVTDLPIGVGLGVRTGEQARQIAEYADAV
IVGSAFLDAYARGGRDAAAALAGEFAAGIRAARADGTARADGTARADRSADSAPVSSGSV
AQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagccagccgaccagccagccgcccagccagccgacagtcctggccgagctgttc
gccggcctgcgggcgcagaaccgggccgccctggtgggctacctgccggccggctacccg
gacctggccgcgtccaaggacctgtacgccgcgatcatcgaggggggctgcgacctggtc
gaggtcggcctgccgttctccgacccggtcctggacggcccggtcatccagcacgccgcc
cagcaggccctggccggcggcttccgggtccgcgacaccttcgagatcgttgagtcgatc
accgcccgcggtggccgcgccgtcgtgatgacctacttcaacccggtgctggcctacggg
gtcgacgcgttcgcccgggacctggccgcggccgggggagcgggcgtgatcacccccgac
ctgatcgtcgacgaggccggcccctggctggacgcggtccatgcgcacggcatcgacccg
atcttcctggtcgccccgtcgtcgtcggcggagcggatcgcgctcaccgcggcctccggc
gggggcttcgtctacgccgcctcggtgatgggcgtgaccggggcccgggaccaggtgtcc
agcgcggcgcccgatctggtcgcccgctgccgcaccgtgaccgacctgccgatcggcgtc
gggctgggcgtacgcaccggcgagcaggcccggcagatcgccgagtacgccgacgcggtg
atcgtcggcagcgcgttcctggacgcctacgcccgcggtggccgggacgccgccgccgcg
ctggccggcgagttcgccgccggcatccgggccgctcgcgccgatggaaccgcccgcgcc
gacggaaccgcccgcgctgatcgaagtgccgattctgcgcccgtttcgtccggttccgtg
gcgcaatga

DBGET integrated database retrieval system