KEGG   Nakamurella multipartita: Namu_3074Help
Entry
Namu_3074         CDS       T00991                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nml  Nakamurella multipartita
Pathway
nml00260  Glycine, serine and threonine metabolism
nml00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01130  Biosynthesis of antibiotics
nml01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Namu_3074
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Namu_3074
Enzymes [BR:nml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Namu_3074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth PT
Motif
Other DBs
NCBI-ProteinID: ACV79408
UniProt: C8XBQ4
Position
complement(3390474..3391382)
Genome map
AA seq 302 aa AA seqDB search
MTSQPTSQPPSQPTVLAELFAGLRAQNRAALVGYLPAGYPDLAASKDLYAAIIEGGCDLV
EVGLPFSDPVLDGPVIQHAAQQALAGGFRVRDTFEIVESITARGGRAVVMTYFNPVLAYG
VDAFARDLAAAGGAGVITPDLIVDEAGPWLDAVHAHGIDPIFLVAPSSSAERIALTAASG
GGFVYAASVMGVTGARDQVSSAAPDLVARCRTVTDLPIGVGLGVRTGEQARQIAEYADAV
IVGSAFLDAYARGGRDAAAALAGEFAAGIRAARADGTARADGTARADRSADSAPVSSGSV
AQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagccagccgaccagccagccgcccagccagccgacagtcctggccgagctgttc
gccggcctgcgggcgcagaaccgggccgccctggtgggctacctgccggccggctacccg
gacctggccgcgtccaaggacctgtacgccgcgatcatcgaggggggctgcgacctggtc
gaggtcggcctgccgttctccgacccggtcctggacggcccggtcatccagcacgccgcc
cagcaggccctggccggcggcttccgggtccgcgacaccttcgagatcgttgagtcgatc
accgcccgcggtggccgcgccgtcgtgatgacctacttcaacccggtgctggcctacggg
gtcgacgcgttcgcccgggacctggccgcggccgggggagcgggcgtgatcacccccgac
ctgatcgtcgacgaggccggcccctggctggacgcggtccatgcgcacggcatcgacccg
atcttcctggtcgccccgtcgtcgtcggcggagcggatcgcgctcaccgcggcctccggc
gggggcttcgtctacgccgcctcggtgatgggcgtgaccggggcccgggaccaggtgtcc
agcgcggcgcccgatctggtcgcccgctgccgcaccgtgaccgacctgccgatcggcgtc
gggctgggcgtacgcaccggcgagcaggcccggcagatcgccgagtacgccgacgcggtg
atcgtcggcagcgcgttcctggacgcctacgcccgcggtggccgggacgccgccgccgcg
ctggccggcgagttcgccgccggcatccgggccgctcgcgccgatggaaccgcccgcgcc
gacggaaccgcccgcgctgatcgaagtgccgattctgcgcccgtttcgtccggttccgtg
gcgcaatga

DBGET integrated database retrieval system