KEGG   Nakamurella multipartita: Namu_3075Help
Entry
Namu_3075         CDS       T00991                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nml  Nakamurella multipartita
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Namu_3075
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Namu_3075
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Namu_3075
Enzymes [BR:nml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Namu_3075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3391379..3392650)
Genome map
AA seq 423 aa AA seqDB search
MSVPARAAVDLPRPSDGLAGTDHDPDDRGYFGTMGGRWLPEALVGALDEVADYYRKARRD
PDFLARLDDLAANYAGRPSPLSDAPRLTAEVGGARILLKREDLNHTGSHKINNVLGQALL
AQRMGKTRLIAETGAGQHGVATATAAALLGLECCIYMGRVDTERQALNVARMRLLGAEVV
AVEAGSATLKDAINEAFRDWVATVDHTFYLFGTVAGPHPFPVIVRDFQRIIGLEARAQVL
DRTGRLPDAVAACVGGGSNAMGIFHAFLDDPDVRLVGLEAGGDGIETGRHASTISGGSVG
VLHGARSFLLQDADGQIIESHSISAGLDYPGVGPEHSHLAEIGRAEYRSITDTQAMDAFA
LLARTEGIIPAIESAHAVAGALDLAREIGPEGIVLINVSGRGDKDMETAMQWFKLAEPTG
AVQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcccgcgcgagcggccgtcgatctgccacgcccgtccgacgggctggccggc
accgaccacgatcccgacgaccgcggctacttcggcaccatgggcggccggtggttgccc
gaggccctggtcggggccctggacgaggtcgccgactactaccgcaaggcccgccgggac
cccgatttcctggcccggctggacgacctggcggccaactacgccggccgcccgagcccg
ctgtccgacgccccccggctgaccgccgaggtcggcggcgctcggatcctgctcaagcgc
gaggacctgaaccacaccggcagccacaagatcaacaacgtgctcgggcaggccttgctg
gcccagcgcatgggcaagacccggctgatcgccgagaccggggccggccagcacggggtg
gccaccgccaccgccgcggccctgctcggcctggagtgctgcatctacatgggccgggtc
gacaccgaacggcaggccctgaacgtggcccggatgcggctgctgggcgccgaggtcgtc
gccgtcgaggccggctcggccaccctcaaggacgccatcaacgaggcgttccgggactgg
gtggccaccgtcgaccacaccttctacctgttcggcacggtggccggcccgcatccgttc
ccggtgatcgtccgcgacttccagcggatcatcggcctggaggcccgggcccaggtgctc
gaccgcaccggccggttgcccgacgcggtcgccgcctgcgtcggcggcggctccaacgcg
atgggcatcttccacgccttcctggacgacccggacgtgcggctggtcggcctggaggcc
ggcggcgacggcatcgagaccggacggcacgcctccaccatcagcggcggctcggtcggg
gtgctgcacggcgcccgctccttcctgctgcaggacgccgacggccagatcatcgagtcg
cactcgatcagcgccggactggactaccccggcgtcggccccgagcactcgcacctggcc
gagatcggccgggccgagtaccgctcgatcaccgacacccaggccatggatgcgttcgcg
ctgctggcccggaccgagggcatcatcccggccatcgagtccgcgcacgccgtggccggg
gcgctggacctggcccgggagatcggccccgagggcatcgtgttgatcaacgtctccggc
cggggggacaaggacatggagacggccatgcagtggttcaagctggccgaaccgacggga
gccgtccagtga

DBGET integrated database retrieval system