KEGG   Nakamurella multipartita: Namu_3211Help
Entry
Namu_3211         CDS       T00991                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
nml  Nakamurella multipartita
Pathway
nml00010  Glycolysis / Gluconeogenesis
nml00071  Fatty acid degradation
nml00350  Tyrosine metabolism
nml00620  Pyruvate metabolism
nml00625  Chloroalkane and chloroalkene degradation
nml00626  Naphthalene degradation
nml00650  Butanoate metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_3211
   00620 Pyruvate metabolism
    Namu_3211
   00650 Butanoate metabolism
    Namu_3211
  Lipid metabolism
   00071 Fatty acid degradation
    Namu_3211
  Amino acid metabolism
   00350 Tyrosine metabolism
    Namu_3211
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Namu_3211
   00626 Naphthalene degradation
    Namu_3211
Enzymes [BR:nml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Namu_3211
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Namu_3211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ACV79542
UniProt: C8XCT9
Position
complement(3540456..3543170)
Genome map
AA seq 904 aa AA seqDB search
MAAPTLPAVRTPQELTEGDRLDRPPVNEIDMLVARALTALDEYADFDQEKIDYIVKKAAV
AALDQHGQLAQAAVAETGRGVFEDKAVKNIFACEHVTNSMKYLGTVGVISTDEITGITEI
AEPVGVVAGITPVTNPTSTTIFKSLLALKTRNPIVFGFHPAAQQSSALAARIVRDAAVAA
GAPEHCIQWIEHPSIEATGALMNHPDVATILATGGNAMVKAAYSCGKPALGVGAGNVPAF
IERTAQLARAVNDVVVSKSFDNGMICASEQAVILDEPIYEQAMAEFDRLHAYRANAQEKA
RLEEFLFGVRADGTACGGAKLNAAAVGQSPQWIARGAGFEVPEETSIILVEVPFVGPGQP
LTREKLCPVLAVLAARDAQHGIELAEQMVELDGLGHSAAIHTGDEALAVEFGRRVKAVRI
IRDSPTSMGGIGDIYNALAPSLTLSCGSYGHNSVSGNVSAINLVNIKRVARRNNNLQWFK
VPAKTYFEPNAVRYLIDMPDVHRVTIVTDSTMTKLGFADRIIDVLRRRQQPVSLQIIDGV
EPEPSVQTVYKGADLMRDFKPDTIIALGGGSPMDAAKVMWLLYEHPDTVFADLKEKFFDV
RKRAFRFPRLGALAKLVCVPTTSGTGAEVTPFAVITDPTTGVKYPLADYALTPTVAIIDP
VLTGKMPASLAADSGFDALTHATEAFVSVYANDFTDGMALQAIRLIFANLATSVNGDPKD
PATVKAREKMHNAGTIAGMAFGNAFLGIVHAMAHTIGGRYHLVHGRTNATLLPHVIRYNG
TVPTKLTSWPKYESYVAPERFQQIAAMLGLPAATPAEGVESYATAVEQLRAMVGIPASFQ
AQGVDEQVFLGELDLLAMGAYRDQCAPANPRMPMLADMKVIMTAAYYGIGYQPAKARLDA
VAVS
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacccaccctgcccgccgttcgtaccccgcaggagctgaccgagggtgaccgg
ctcgaccggccgccggtcaatgagatcgacatgctggtcgcgcgcgccctgaccgcgctc
gacgagtacgccgacttcgaccaggagaagatcgactacatcgtcaagaaggccgccgtc
gccgcgctggatcagcacggccagctggcccaggccgccgtcgccgagaccgggcgcggc
gtgttcgaggacaaggccgtcaagaacatcttcgcctgcgagcacgtcaccaactccatg
aagtacctgggcaccgtgggcgtgatcagcaccgacgagatcaccggcatcaccgagatc
gccgagccggtcggcgtcgtcgccggcatcaccccggtcaccaacccgacctcgaccacc
atcttcaagagcctgctggccctcaagacccgcaacccgatcgtcttcgggttccacccg
gccgcccagcagtcctcggccctggccgcccggatcgtccgcgacgcggcggtcgccgcc
ggcgcccccgagcactgcatccagtggatcgagcacccctcgatcgaggccaccggcgcg
ctgatgaaccacccggacgtcgccaccatcctggccaccggcggcaacgccatggtcaag
gccgcctacagctgcggcaagccggccctgggcgtcggcgccggcaacgtgcccgccttc
atcgagcgcaccgcccaactggcccgcgcggtcaacgacgtggtcgtgtccaagtcgttc
gacaacgggatgatctgtgcctcggagcaggcggtcatcctggacgagccgatctacgaa
caagcgatggccgagttcgaccggctgcacgcctaccgcgccaacgcgcaggagaaggcg
cggctcgaggagttcctcttcggggtccgggccgacgggaccgcctgcggcggagccaag
ctcaacgccgcggcggtcgggcagagcccgcaatggatcgcccgcggggccggcttcgag
gtgcccgaggagacctcgatcatcctggtcgaggtgccgttcgtcggaccgggtcagcca
ctgacccgggagaagctgtgcccggtgctggccgtgctggccgcccgcgacgcgcagcac
gggatcgagctggccgagcagatggtcgagttggacggcttgggccacagcgccgccatc
cacaccggtgacgaggcactcgcggtcgagttcggccggcgggtcaaggccgtgcggatc
atccgcgattcgcccacctcgatgggcggcatcggcgacatctacaacgcgctggcgccg
tcgctgaccctgtcctgcggttcgtacgggcacaactcggtttcgggcaacgtctcggcg
atcaacctggtcaacatcaagcgggtggcccggcgcaacaacaacctgcagtggttcaag
gtgccggccaagacctacttcgagccgaacgcggtccggtacctgatcgacatgcccgac
gtgcaccgggtcaccatcgtcactgactcgacgatgaccaagctcggcttcgccgaccgg
atcatcgacgtgctgcgccgccggcagcagccggtctcgctgcagatcatcgacggcgtg
gagcccgaaccgagcgtgcagaccgtctacaagggggcggatctgatgcgggacttcaag
cccgacaccatcatcgccctcggcggcggttcgccgatggacgcggccaaggtgatgtgg
ctgctctacgagcacccggacaccgtcttcgccgacctgaaggagaagttcttcgacgtg
cgcaagcgcgcgttccgcttcccccggctgggcgccctggccaagctggtctgcgtgccg
accacgtccggcaccggcgccgaagtgaccccgttcgcggtgatcaccgacccgaccacc
ggggtgaagtacccgctggccgactacgcgctgaccccgaccgtggccatcatcgacccg
gtgctgaccggcaagatgccggcctcgctggccgccgactcgggcttcgacgcgctgacc
cacgccaccgaggcgttcgtgtcggtgtacgcgaacgacttcaccgacggcatggccctg
caggccatccggctgatcttcgcgaacctggccacttcggtgaacggtgacccgaaggac
ccggccacggtcaaggcccgggagaagatgcacaacgccggcaccatcgccggcatggcc
ttcggcaacgccttcctgggcatcgtgcacgccatggcccacaccatcggcgggcgctac
cacctggtgcacggccggaccaacgccacgctgctcccgcacgtgatccgctacaacggc
accgtgccgaccaagctgaccagctggcccaagtacgagagctatgtcgcgccggagcgg
ttccagcagatcgcggccatgctcgggctgccggcggccaccccggccgaaggtgtcgag
tcctacgccaccgcggtcgagcagctgcgggcgatggtcggcatcccggcctcgttccag
gcccagggggtggacgagcaggtcttcctcggcgagctcgacctgctggccatgggggcc
taccgcgaccagtgcgcgccggccaacccgcggatgccgatgctggccgacatgaaggtg
atcatgacggccgcctactacggcatcggctaccagccggccaaggcgcggctggacgcg
gtcgcagtcagctga

DBGET integrated database retrieval system