KEGG   Nakamurella multipartita: Namu_3228Help
Entry
Namu_3228         CDS       T00991                                 

Definition
acylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
nml  Nakamurella multipartita
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3557706..3558473
Genome map
AA seq 255 aa AA seqDB search
MTRSTTDRDFGPFRHDGSDVGVLLCHGFPGAPGSMRPWADHLAAAGYSVRLPLLPGHGTR
WQDANRTTFDDWLAAVTREFQELSATCRSVVVCGLSMGGTLTLRLAELYPDQPAGIVLVN
PSVLTQRWDAKLLLPWLQRVLPAYPGIIGDIAMPGVTEPGYKYIPTRAAYSLSKAWPIVR
RDLPRITAPVLLLHSTVDHIVEPVNAQVVRDEVGSADVTVIELTRSFHVATMDYDAPLIF
DASVEFIEKVTASLP
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcagcacgaccgaccgggacttcggcccgttccgtcacgacggttcggacgtc
ggcgtgctgctgtgccacgggtttcccggcgcccccgggtcgatgcggccgtgggcggat
catctggccgcggccgggtactcggtccggctgccgctgctgccgggccacggcacccgc
tggcaggacgctaaccgcaccaccttcgacgactggctggccgcggtcacccgggagttc
caggagctcagcgccacctgccggtccgtcgtggtctgcggcctgtccatgggcggcacg
ctgaccttgcggctggccgagctgtacccggaccagccggccgggatcgtgctggtcaac
ccgtcggtgctgacccagcgctgggacgccaagctcctgctgccctggttgcagcgggta
ctgccggcctaccccggcatcatcggcgacatcgccatgcccggggtcaccgagcccggc
tacaagtacatcccgacccgcgcggcctactccctgtccaaggcgtggcccatcgtccgc
cgggacctgcccaggatcaccgctccggtgttgctactgcactcgacggtggaccacatc
gtcgagccggtcaacgcgcaggtcgtccgggacgaggtgggttcggccgacgtcaccgtg
atcgagctcactcgcagctttcacgtcgcgaccatggactacgacgccccgctgatcttc
gacgcgtcggtggagttcatcgagaaagtcaccgcgagcctgccgtga

DBGET integrated database retrieval system