KEGG   Nakamurella multipartita: Namu_3230Help
Entry
Namu_3230         CDS       T00991                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nml  Nakamurella multipartita
Pathway
nml00010  Glycolysis / Gluconeogenesis
nml00052  Galactose metabolism
nml00500  Starch and sucrose metabolism
nml00520  Amino sugar and nucleotide sugar metabolism
nml00521  Streptomycin biosynthesis
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01200  Carbon metabolism
Module
nml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nml_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_3230
   00052 Galactose metabolism
    Namu_3230
   00500 Starch and sucrose metabolism
    Namu_3230
   00520 Amino sugar and nucleotide sugar metabolism
    Namu_3230
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Namu_3230
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Namu_3230
Enzymes [BR:nml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Namu_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK TCR
Motif
Other DBs
NCBI-ProteinID: ACV79561
UniProt: C8XCV8
Position
complement(3559148..3560092)
Genome map
AA seq 314 aa AA seqDB search
MSKTIGIDIGGTSVRAAVIDGISIGPSLREATPHTERETEDLLVTLITKLAASQPVSAVG
LAVAGFVSADRQRVMFAPHLAWRDAPVPERVSARVGLPVVMDHDVNSAAWAEYRLGVSAG
SSIALLVALGTGIGAGLLVDGQIYRGAHGVAPELGHLTVVPGGRPCPCGKQGCWERYCSG
TALAQTARLQMADHDAPVLRRLSGDDPAAVTGTMVAVAATEGDPVALGAMDELGHWLAAG
LALVTDVLDPEMIVIGGGVSAAAGMFLPLAVSEFGRSITGAGHRPLPRVELARFGDRAGI
IGAALLAAEAAGTA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccatcggcatcgacatcggcggtacctcggtgcgcgcggccgtcatcgac
ggcatctccatcggcccgtccctgcgtgaggccaccccgcacaccgaacgggagaccgag
gacctgctggtcacgctgatcaccaagttggcggccagccagccggtgtccgcggtcggg
ctggccgtggccgggttcgtcagcgccgaccggcagcgggtcatgttcgccccgcacctg
gcctggcgggacgctccggtgcccgagcgggtgtccgcccgggtgggcctgccggtagtg
atggaccacgacgtgaactccgcggcctgggccgagtaccgcctgggcgtgtccgcggga
tcctccatcgccctgctggtcgccctgggcacggggatcggtgccgggctgctcgtcgac
ggccagatctaccgcggggcgcacggcgtggcgcccgagctcggtcacctgaccgtcgtc
cccggcggccggccctgcccgtgcggcaagcaagggtgctgggagcgttactgctcgggc
accgcgttggcccagactgcccggctgcagatggccgaccatgacgcgccggtgctgcgc
cgactgtccggggacgacccggccgccgtcaccgggaccatggtcgcggtggccgccacc
gagggcgacccggtcgccctgggcgcgatggacgagctcggccattggctggccgccggc
ctggcgctggtcaccgacgtgctcgacccggagatgatcgtgatcggcggtggggtgtcg
gccgcggccggcatgttcctgccgctggccgtgtccgagttcggccggtccatcaccggc
gccggccaccggccgttgccacgggtcgaactggcccggttcggcgaccgggccggcatc
attggggccgcgctgctggcggccgaggccgccggcaccgcctga

DBGET integrated database retrieval system