KEGG   Nakamurella multipartita: Namu_3256Help
Entry
Namu_3256         CDS       T00991                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nml  Nakamurella multipartita
Pathway
nml00250  Alanine, aspartate and glutamate metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Namu_3256
Enzymes [BR:nml01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Namu_3256
Peptidases [BR:nml01002]
 Cysteine Peptidases
  Family C44
   Namu_3256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ACV79587
UniProt: C8XCY4
Position
3584578..3586482
Genome map
AA seq 634 aa AA seqDB search
MGFVSGSGHAATRVAAVDAGMRCARHRGPDEQGTWHDDDVVFGFNRLSIIDLEHSHQPLR
WGPPEAPERYALVFNGEIYNYLELRAELTAEFGTQFATQGDGEAIVAAYHHWGQAAVARL
RGMFAFLIWDTQDRVLFGARDPFGVKPLFVAQLPDGIAFSSEAKGLRELTGAARVNVPAL
QHYLVLQYVPEPATMDPAIRKIESGTHLTVRPGRPMATKRYFHPVFASRPAISDAERSAL
YQRIAEVMDDSVAKHMRADVTVGAFLSGGIDSTAIAALAKRYNPDLLTFTTGFEREGFSE
VDVAAESAAAIGVEHIVRTVSEQELTSTLPLIVWYLDDPVADPALVPLYFVANEARKHVK
VVLSGEGADELFGGYNIYREPMSLRSITGLPGGLRKGLAAVGRAMPEGFRGQDMLRRGSL
ELEDRYYGNARIFREEHLSGGLLRTYDPARSFRDITDPIYAQTKEVDPIARMQHVDLFTW
LRGDILVKADKMTMANSLELRVPFLDKEVFEVARTVPADQKVTKNTTKLALRRAMELVVP
PHVLHRRKLGFPVPIRHYLAEGSYEWAREVITSAHTDEYLDPAAVLAMLDAHRAGEADHS
RRLWTILVFQIWHGIFVTGQITPQIPEPVYPVRL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgggttttgtctccggatcgggccatgcggcgacccgggtcgcggcggtggacgcggga
atgcgctgcgcccgccatcgcggacccgacgagcagggcacctggcatgacgacgacgtc
gtcttcgggttcaaccggctctcgatcatcgacctggagcattcgcaccagccgctgcgc
tgggggccgcccgaggcgcccgagcggtacgcgctggtgttcaacggcgagatctacaac
tacctggagctgcgggccgagctgacggccgagttcggcacgcagttcgccacccagggc
gacggcgaggccatcgtggccgcttaccaccattggggccaggcggccgtggcccggttg
cgcggcatgttcgccttcctgatctgggacacccaggaccgggtgctcttcggcgcccgg
gacccattcggcgtcaagccgctgttcgtggcccagttgcccgacggcatcgccttctcc
tccgaggccaaggggctgcgcgagctcaccggggcggcccgggtgaacgtcccggccctg
cagcactacctggtcctgcagtacgtgcccgagcccgccaccatggaccccgccatccgc
aagatcgagtccggcacccatctgaccgtccggccgggccggccgatggccaccaagcgc
tacttccacccggtgttcgcatcccggccggcgatctccgacgccgagcgcagcgcgctg
taccagcggatcgccgaggtgatggacgactcggtggccaagcacatgcgcgcggacgtg
accgtcggcgcgttcctgtccggcggcatcgactcgaccgcgatcgccgcactggccaag
cgctacaacccggacctgctgaccttcaccaccggcttcgagcgggagggcttctccgag
gtcgacgtggccgccgagtcggccgccgcgatcggcgtcgagcacatcgtgcggaccgtg
tccgagcaggagctgaccagcacgctgccgctgatcgtctggtacctggacgacccggtc
gccgacccggccctggtccccctctatttcgtggccaacgaggcccgcaagcacgtcaag
gtggtgctctccggcgagggcgccgacgagctgttcggcggctacaacatctaccgcgag
ccgatgagcctgcggagcatcaccgggctgcccggcgggctgcgcaagggcctggccgcg
gtcggacgggccatgccggagggcttccggggccaggacatgctgcggcgcggctcgctg
gagctggaggaccgctattacggcaacgcccggatcttccgcgaggagcacctgtccggg
ggtctgctgcggacctacgacccggcccgctcgttccgggacatcaccgacccgatctac
gcgcagaccaaggaggtcgacccgatcgcccggatgcagcacgtcgacctgttcacctgg
ctgcgcggggacatcctggtcaaggccgacaagatgaccatggccaactcgctcgagctt
cgggtgccgttcctggacaaggaggtcttcgaggttgcgcggacggtgccggccgaccag
aaggtgaccaagaacacgaccaagctcgccctgcgccgggccatggaactggtcgtgccg
ccgcacgtgctgcaccggcgcaagctcggcttcccggtgccgatccggcactacctggcc
gaggggtcctacgagtgggcccgcgaggtcatcacctcggcgcacaccgacgagtatctg
gatccggcggcggtgctggccatgctggacgcgcaccgggccggcgaggccgaccattcc
cgccggctctggacgatcctggtctttcagatctggcacgggatcttcgtcaccggccag
atcaccccgcagatcccggaaccggtgtacccggtccggctctag

DBGET integrated database retrieval system