KEGG   Nakamurella multipartita: Namu_3256Help
Entry
Namu_3256         CDS       T00991                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nml  Nakamurella multipartita
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Namu_3256
Enzymes [BR:nml01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Namu_3256
Peptidases [BR:nml01002]
 Cysteine Peptidases
  Family C44
   Namu_3256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3584578..3586482
Genome map
AA seq 634 aa AA seqDB search
MGFVSGSGHAATRVAAVDAGMRCARHRGPDEQGTWHDDDVVFGFNRLSIIDLEHSHQPLR
WGPPEAPERYALVFNGEIYNYLELRAELTAEFGTQFATQGDGEAIVAAYHHWGQAAVARL
RGMFAFLIWDTQDRVLFGARDPFGVKPLFVAQLPDGIAFSSEAKGLRELTGAARVNVPAL
QHYLVLQYVPEPATMDPAIRKIESGTHLTVRPGRPMATKRYFHPVFASRPAISDAERSAL
YQRIAEVMDDSVAKHMRADVTVGAFLSGGIDSTAIAALAKRYNPDLLTFTTGFEREGFSE
VDVAAESAAAIGVEHIVRTVSEQELTSTLPLIVWYLDDPVADPALVPLYFVANEARKHVK
VVLSGEGADELFGGYNIYREPMSLRSITGLPGGLRKGLAAVGRAMPEGFRGQDMLRRGSL
ELEDRYYGNARIFREEHLSGGLLRTYDPARSFRDITDPIYAQTKEVDPIARMQHVDLFTW
LRGDILVKADKMTMANSLELRVPFLDKEVFEVARTVPADQKVTKNTTKLALRRAMELVVP
PHVLHRRKLGFPVPIRHYLAEGSYEWAREVITSAHTDEYLDPAAVLAMLDAHRAGEADHS
RRLWTILVFQIWHGIFVTGQITPQIPEPVYPVRL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgggttttgtctccggatcgggccatgcggcgacccgggtcgcggcggtggacgcggga
atgcgctgcgcccgccatcgcggacccgacgagcagggcacctggcatgacgacgacgtc
gtcttcgggttcaaccggctctcgatcatcgacctggagcattcgcaccagccgctgcgc
tgggggccgcccgaggcgcccgagcggtacgcgctggtgttcaacggcgagatctacaac
tacctggagctgcgggccgagctgacggccgagttcggcacgcagttcgccacccagggc
gacggcgaggccatcgtggccgcttaccaccattggggccaggcggccgtggcccggttg
cgcggcatgttcgccttcctgatctgggacacccaggaccgggtgctcttcggcgcccgg
gacccattcggcgtcaagccgctgttcgtggcccagttgcccgacggcatcgccttctcc
tccgaggccaaggggctgcgcgagctcaccggggcggcccgggtgaacgtcccggccctg
cagcactacctggtcctgcagtacgtgcccgagcccgccaccatggaccccgccatccgc
aagatcgagtccggcacccatctgaccgtccggccgggccggccgatggccaccaagcgc
tacttccacccggtgttcgcatcccggccggcgatctccgacgccgagcgcagcgcgctg
taccagcggatcgccgaggtgatggacgactcggtggccaagcacatgcgcgcggacgtg
accgtcggcgcgttcctgtccggcggcatcgactcgaccgcgatcgccgcactggccaag
cgctacaacccggacctgctgaccttcaccaccggcttcgagcgggagggcttctccgag
gtcgacgtggccgccgagtcggccgccgcgatcggcgtcgagcacatcgtgcggaccgtg
tccgagcaggagctgaccagcacgctgccgctgatcgtctggtacctggacgacccggtc
gccgacccggccctggtccccctctatttcgtggccaacgaggcccgcaagcacgtcaag
gtggtgctctccggcgagggcgccgacgagctgttcggcggctacaacatctaccgcgag
ccgatgagcctgcggagcatcaccgggctgcccggcgggctgcgcaagggcctggccgcg
gtcggacgggccatgccggagggcttccggggccaggacatgctgcggcgcggctcgctg
gagctggaggaccgctattacggcaacgcccggatcttccgcgaggagcacctgtccggg
ggtctgctgcggacctacgacccggcccgctcgttccgggacatcaccgacccgatctac
gcgcagaccaaggaggtcgacccgatcgcccggatgcagcacgtcgacctgttcacctgg
ctgcgcggggacatcctggtcaaggccgacaagatgaccatggccaactcgctcgagctt
cgggtgccgttcctggacaaggaggtcttcgaggttgcgcggacggtgccggccgaccag
aaggtgaccaagaacacgaccaagctcgccctgcgccgggccatggaactggtcgtgccg
ccgcacgtgctgcaccggcgcaagctcggcttcccggtgccgatccggcactacctggcc
gaggggtcctacgagtgggcccgcgaggtcatcacctcggcgcacaccgacgagtatctg
gatccggcggcggtgctggccatgctggacgcgcaccgggccggcgaggccgaccattcc
cgccggctctggacgatcctggtctttcagatctggcacgggatcttcgtcaccggccag
atcaccccgcagatcccggaaccggtgtacccggtccggctctag

DBGET integrated database retrieval system