KEGG   Nakamurella multipartita: Namu_3643Help
Entry
Namu_3643         CDS       T00991                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
nml  Nakamurella multipartita
Pathway
nml00790  Folate biosynthesis
nml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Namu_3643
Enzymes [BR:nml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Namu_3643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI Pyr_redox Bac_globin
Motif
Other DBs
NCBI-ProteinID: ACV79955
UniProt: C8XFH8
Position
complement(3997956..3998636)
Genome map
AA seq 226 aa AA seqDB search
MTAALPQSPSARPRPGPPEPVNRRHHHPLRVVHPTAPVDLAAAERAAAAFLAALGVDVAT
ENRRDTPGRMARAYAEMFTPRPFDLTTFPNDDGYDEMVLARAIPVQSVCEHHLLPFVGVA
HVGYLPGDRILGLSKLARVVELFARQPQVQERLTQQVADWLQTTLEPRGVGVVIEAEHLC
MTMRGVHADGVTTVTSAVQGHLRQDAAARAEFFALALPRPTNRRRP
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcggctctcccgcagtcccccagcgcacggccccgccccgggccgccggaaccg
gtcaaccggcgtcatcatcacccgctgcgggtggtccacccgacggcaccggtcgatctg
gccgccgcggaacgcgccgcggccgccttcctggccgcgctcggcgtggacgtggccacc
gagaatcgacgggacaccccgggccggatggcccgggcctacgcagagatgttcaccccc
cggcccttcgacctgaccaccttccccaacgacgacggctacgacgagatggtgctcgcc
cgggccattccggtgcagtcggtgtgcgagcaccatctgttgccgttcgtcggggtcgcc
cacgtcgggtacctgcccggagaccggatcctcgggttgtcgaagctggcccgggtggtg
gagttgttcgcccggcagccccaggtgcaggagcggctgacccagcaggtcgccgactgg
ctgcagaccaccctggagccccgaggcgtgggcgtggtcatcgaggccgagcacctgtgc
atgacgatgcgtggtgtccacgccgacggggtcaccaccgtcacctcggccgtgcagggg
cacctgcggcaggacgccgccgcccgcgccgagttcttcgccctcgccctgccgcggccg
acgaaccggcgtcggccatga

DBGET integrated database retrieval system