KEGG   Nakamurella multipartita: Namu_3917Help
Entry
Namu_3917         CDS       T00991                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
nml  Nakamurella multipartita
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Namu_3917
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Namu_3917
Enzymes [BR:nml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Namu_3917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4323398..4324180)
Genome map
AA seq 260 aa AA seqDB search
MTQPSMNQSRPLAGRTALVTGAASGIGRAITERFLQDGAQVVAVDRDAERLGKMCADTGA
TPLVIDLSDIAGLPAAIADVAPTVDVLVNDAGIQHVERIEDFPIETFETILKIMLTAPFV
LTRAVLPGMYERGWGRIINVSSAHGRRASPFKSAYVTAKHGLEGLSKVIALEGAAKGVTS
NCINPGYVRTPLVEKQITNQAAVHDLPEDEVLAKIILTSSPVKRLIEPEEVAAAAAFLCT
PACNSMTGSDLVLDGGWGAR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacacagccgtccatgaaccagtcgcgacccctggccggccgcaccgccctcgtcacc
ggggcggccagcggcatcggccgggccatcaccgagcgtttcctccaggacggcgcccag
gtggtggcggtcgaccgtgacgccgagcggctcggcaagatgtgcgcggacaccggcgcg
actccactggtcatcgacctgtccgacatcgccgggctgccggcggccatcgccgacgtc
gccccgacggtggacgtcctggtcaacgacgccggcatccagcatgtggaacggatcgag
gacttcccgatcgagaccttcgagacgatcctgaagatcatgctcaccgccccgttcgtg
ctcacccgggccgtgctgccggggatgtacgagcgcggctggggccggatcatcaacgtc
tcctccgcgcacggccggcgggccagcccgttcaagtcggcctacgtcacggccaagcac
ggcctggaagggctgagcaaggtcatcgccctggagggcgccgccaagggcgtcaccagc
aactgcatcaaccccggttacgtgcgaaccccgttggtggaaaagcagatcaccaatcag
gcggccgtgcacgacctgcccgaggacgaggtactggccaagatcatcctgacctcgtcg
ccggtcaagcggctgatcgagccggaagaggtggcggccgccgccgcgttcctgtgcacg
ccggcctgcaactcgatgaccggctcggacctggtgctcgacggcggttggggcgcccgc
tga

DBGET integrated database retrieval system