KEGG   Nakamurella multipartita: Namu_4279Help
Entry
Namu_4279         CDS       T00991                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nml  Nakamurella multipartita
Pathway
nml00240  Pyrimidine metabolism
nml00250  Alanine, aspartate and glutamate metabolism
nml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Namu_4279
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Namu_4279
Enzymes [BR:nml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Namu_4279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACV80567
UniProt: C8XJK6
Position
complement(4761503..4762441)
Genome map
AA seq 312 aa AA seqDB search
MPTMPRHLLSAGDLTRGSAELILDTAERIDQAMAGREVRKLPTLRGRTVVNLFFEDSTRT
RISFELAAKRLSADVINFSAKGSSVSKGESLKDTAWTLQAMGADAVVCRHSASGAPQQLS
GWVDGHVINAGDGTHEHPTQALLDAFTLRRHLGRLDGRRIVVVGDVLHSRVARSNVLLLS
TLGAQVTLVAPPTLVPVGVDAWPAQVSYDLDGALTGADAVMMLRVQRERMSGAFFPTERE
YSRGYGLDERRRALLADDAIVMHPGPMNRGMEITPGVADGVNSVIVEQVANGVTVRMAVL
YLLLSGEMDGGL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaccatgccgcggcacctgctctcggccggcgacctgacccgcggctcggccgag
ctgatcctggacaccgccgagcggatcgaccaggcgatggccggccgggaggtgcgcaag
ctgcccaccctgcgcgggcgcaccgtggtcaacctgttcttcgaggactccacccggacc
cggatctcgttcgagctggccgccaagcgcctgtccgccgacgtcatcaacttctcggcc
aagggttcgtcggtgtccaagggcgagtcgctcaaggacaccgcctggaccctgcaggcc
atgggcgccgacgccgtcgtctgccggcactcggcctccggggcgccgcagcagctctcc
ggctgggtggacgggcacgtgatcaacgccggcgacggcacccacgagcaccccacccag
gcgttgctggacgccttcaccctgcgccggcacctgggccggctggacggccggcggatc
gtggtggtcggcgacgtgctgcactcgcgggtggcccggtccaacgtgctgctgctgtcc
accctgggcgcgcaggtcaccctggttgcgccgcccaccctggtcccggtcggggtggac
gcctggcccgcgcaggtgtcctacgacctggacggcgcgctgaccggggccgatgccgtg
atgatgctgcgggtgcagcgggagcggatgagcggcgcgttcttcccgaccgagcgcgag
tacagccgcgggtacgggctggacgaacggcgccgcgcgctgctggccgacgacgcaatc
gtcatgcaccccggcccgatgaaccggggcatggagatcaccccgggcgtggccgacggg
gtcaactcggtgatcgtcgagcaggtcgccaacggggtgaccgtgcggatggccgtgctg
tatctgctgctctccggcgagatggatggtggattgtga

DBGET integrated database retrieval system