KEGG   Nakamurella multipartita: Namu_4555Help
Entry
Namu_4555         CDS       T00991                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nml  Nakamurella multipartita
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:nml00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5069740..5070693)
Genome map
AA seq 317 aa AA seqDB search
MMASNSGPTALAPAGPSVRVRAPAKINLYLAVGDVREDGYHDLVTVFQAVDLADELTVRP
ARRSAVRTTPPDGVPVGAKNLAGVAARLLATRTKSGGPVAIDIAKQIPVAGGMAGGSADA
AAALVGCAALWELRVQRQELIEIGREIGADVPFALAGGTALGTGRGDLLSPVMTRARLHW
VLAIADHGLSTPAVFAELDRLRAQGGGPPPVRPVDTMLAALTSGEPAKIAAALGNDLQAA
AISLAPGLRRTLRAGEQAGALGGLVSGSGPTVALLCADAESAGAVAAELAGSGTCRSVRV
AAGPAPGARVLPNGGTG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatggcctcgaactccggcccgacggcgcttgcgcccgcgggtccgtcggtgcgggtc
cgggcgccggccaagatcaacctgtacctggccgtcggtgacgtgcgcgaggacggctac
cacgatctggtgaccgtgttccaggccgttgacctggccgacgagctcaccgtgcgaccg
gcccgccggtccgcggtgcgcaccacgccgccggacggcgtgccggtgggggccaagaac
ctggccggggtcgcggcccggctgctggccacccgcaccaagtccggtggcccggtggcc
atcgacatcgccaagcagatcccggtggccggcgggatggccggcggcagcgccgatgcc
gcggccgcgctggttggctgcgccgccctgtgggagctgcgggtgcagcggcaggaattg
atcgagatcggccgggagatcggggccgacgtgccgttcgcgctcgccggcggcaccgcg
ctgggcaccgggcggggcgatctgctgtccccggtgatgacccgggcccggctgcactgg
gtgctggccatcgccgatcacggcctgtccaccccggccgtgttcgccgagctggaccgg
ctgcgggcccagggcggcgggcccccaccggtgcgcccggtggacaccatgctggccgcc
ctgaccagcggcgagccggccaagatcgccgccgcgttgggcaacgacctgcaggccgcc
gcgatctcactggcccccgggttgcgccgcaccctgcgggcgggggagcaggcgggcgcg
ctgggcgggctggtctccggatcggggccgaccgtcgccctgctgtgcgccgacgcggaa
tcggccggcgcggtggccgccgaactggccgggtccggaacctgccgatccgtgcgggtg
gccgccggcccagccccgggggcccgggtcctgcccaacggagggaccggctga

DBGET integrated database retrieval system