KEGG   Nakamurella multipartita: Namu_4806Help
Entry
Namu_4806         CDS       T00991                                 

Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
nml  Nakamurella multipartita
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Namu_4806
  Energy metabolism
   00680 Methane metabolism
    Namu_4806
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Namu_4806
Enzymes [BR:nml01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Namu_4806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5345216..5346445
Genome map
AA seq 409 aa AA seqDB search
MSNNRAVTYQGPMKVAVQDIAYPTFELQDGPGVNPLNVGRKVPHGAILKVVTTNICGSDQ
HMVRGRTTAPEGLVLGHEITGEVIETGPGVEFIQVGDICSVPFNIACGRCKNCKEGKTGI
CLNVNPDRPGSAYGYVDMGGWVGGQAEYVLVPYADWNLLKFPDRDQALEKILDLTMLSDI
FPTGYHGAYTAGTTTGSTVYVAGAGPVGLAAAVSAQLLGAAVVIVGDLNEDRLAKARSIG
CETVDVSKGDPKDQIEQILGVPEVDCAVDAVGFEARGHGKDASHEAPATVLNSIMDLTAA
GGGLGIPGLYVTGDPGAVDDAAKIGSLSIRLGLGWAKSLSFTTGQCPVMKYHRGLMNAIL
HDKVKIGDAVNATVIGLDQAPKGYAEFDSGVARKYVIDPHNTTGKVSPN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacaaccgcgccgtgacctatcagggcccgatgaaggtggccgtccaggacatc
gcatacccgaccttcgaactgcaggacggacccggcgtcaatcccctcaacgtcggccgc
aaggtgccgcacggcgccattctcaaggtcgtcaccaccaacatctgcggctccgaccag
cacatggtccgcggccgcaccaccgcccccgagggcctggtgctgggccacgagatcacc
ggtgaggtgatcgagaccgggcccggcgtcgagttcatccaggtcggcgacatctgttcg
gtccccttcaacatcgcctgcggccgctgcaagaactgcaaggagggcaagaccggcatc
tgcctgaacgtcaacccggatcggcccggttccgcctacgggtacgtggacatgggtggc
tgggtcggcgggcaggccgaatacgtgctggtgccctacgccgactggaacctgctcaag
ttcccggatcgggatcaggccctggagaagatcctggacctgacgatgctctcggacatc
ttccccaccgggtaccacggcgcctacaccgccggcaccaccacggggtccaccgtgtac
gtggccggcgccggcccggtcgggctggccgccgcggtctcggcccagttgctgggcgcg
gcggtggtcatcgtcggcgatctcaacgaggaccggctggccaaggcccgctccatcggc
tgcgagacggtcgacgtgtccaagggtgacccgaaggaccagatcgagcagatcctcggc
gttcccgaggtcgattgtgccgtggacgcggtcggtttcgaggcccgcgggcacggcaag
gacgccagccacgaggctccggccaccgtgctgaactcgatcatggacctgaccgccgcg
ggtggcggactgggcatcccggggctgtacgtcaccggcgacccgggcgccgtcgacgac
gccgccaagatcggttcgctgtccatccggctgggtctggggtgggcgaagtcgttgtcg
ttcaccacgggtcagtgcccggtgatgaagtaccaccgcggcctgatgaacgcgatcctg
cacgacaaggtcaagatcggtgacgcggtgaacgccaccgtcatcggcctggaccaggcg
ccgaagggatacgccgagttcgactccggggtcgcccgcaagtacgtcatcgacccgcac
aacacgaccggaaaggtcagcccgaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system