KEGG   Nakamurella multipartita: Namu_4821Help
Entry
Namu_4821         CDS       T00991                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
nml  Nakamurella multipartita
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_4821
Enzymes [BR:nml01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Namu_4821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5373010..5373897
Genome map
AA seq 295 aa AA seqDB search
MTQPPSSDLTLPDGVRVVAGRGGLLAVQVDVPACRGEVYLHGGHVTSWSPLGREVLWLSR
DAVFKPGTAIRGGVPICFPWFAGGPDGGLAPAHGFARTTEWALVGATTDGQWVELILALT
DSEQTRAQWPHSFAVDYRVRMGEDELALLFTVTNTGDAPFTFEEALHSYFAVEDIRSTEV
DGLEGASYLDMVPGADRGPHVLDGPITFTGETDRTFQSTGATAVIRRGPRSVTVARDGSS
SAIVWNPWVDKAAAMADFGDDEWTGMVCVETANVKADAVTLEPGATHTMTAYITI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagccgccctcctccgatctcaccctccccgacggcgtgcgggtcgtcgccgga
cgcggtgggctgctggccgtgcaggtcgacgtcccggcgtgccggggcgaggtgtacctg
cacggcgggcacgtcacgtcctggagcccgttgggccgggaagtgctgtggctgagccgg
gacgcggtgttcaagcccggcacggccatccgcggcggcgtgccgatctgctttccctgg
ttcgccggcggccccgacggcggcctggccccggcccacggattcgcccggaccaccgaa
tgggccctggtcggggcgactaccgacggccagtgggtggaactgatcctggccctgacc
gactcggagcagacccgcgcacagtggccgcactcgttcgccgtcgactaccgggtccgg
atgggcgaggacgagctggcgctgttgttcaccgtcaccaacaccggggacgcgcccttc
accttcgaggaggcgctgcacagttacttcgccgtcgaggacatcaggtccaccgaggtg
gacgggctggagggcgcgagctacctggacatggtgccgggggccgaccgcggcccgcac
gtgctcgacggcccgatcaccttcaccggggagaccgaccggaccttccagagcaccggg
gccaccgcggtcatccggcgcggcccccggtcggtcacggtcgcccgcgacgggtcgagc
agcgcgatcgtctggaatccgtgggtggacaaggccgccgccatggccgacttcggcgac
gacgagtggaccggcatggtctgcgtggagacggccaacgtcaaggccgacgcggtgacc
ctggagccgggggccacgcacacgatgaccgcctacatcacgatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system