KEGG   Nakamurella multipartita: Namu_4887Help
Entry
Namu_4887         CDS       T00991                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
nml  Nakamurella multipartita
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Namu_4887
Enzymes [BR:nml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Namu_4887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5447924..5450098)
Genome map
AA seq 724 aa AA seqDB search
MDLPDTLHRLAAAHSIATEFWDWQGRHVQVSDRSITRVLEALGVDVATPDAAEQALRDHD
DAPWRRLLPPALVIRAGWAPTVNVHVRDGAAVDVWIELEGGGYRSSLVQEENWAPARQVG
DRWTGQATFRIPGDLPLGYHRLKAWSEGDEASCALIVTPQRVGLPERLGDRRAWGIATQL
YSVRSAGSWGVGDVVDLEDLSVWGADLGAGYVLINPLHAAEPSGRMEPSPYLPTTRRFQN
PIYLRVERIPEYADLPAADRAEVGSLKAALQQDLAGLDAIDRDTTWTAKAAALRLVHAVP
RSAGRELAYAAYREREGEGLDNYATWCALTDRHGKDWHEWPDELQHPATPEVLAFRAEHA
DDVDFYRWLQFVLDEQLSIAQAATRRSGMALGVMHDLAVGVHPEGSDSWSLQDVFAQGIT
VGAPPDAFNQAGQDWAQPPWRPDRLAEQGYAPFRDMVRTVLRAAGGVRVDHIIGLFRLWW
IPDGMGPTEGTYVRYDHEALIGILALEASRSGAIVVGEDLGTVEPWVREYLSERGILGTS
ILWFEFEFDGDGRPLRPERWREYCLASVTTHDLPPTAGYLAGDHVRLRDELGLLTRSLEE
ELAADDAERAAWIEELRQRGALTAATASSATGKLDPDSPDLAGLELESTVQALHRYLTWT
PSKLLCVALTDMVGDRRTQNQPGTIDEYPNWRVPLTGPDGAPMSLEQVFVSSRARRLAQV
VNES
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgacacgctgcaccggctggccgccgcccacagcatcgccaccgagttc
tgggactggcagggccgtcacgtccaggtctccgatcggtcgatcacccgcgtgctggag
gcgttgggcgtggacgtcgccaccccggacgcggccgagcaggccctgcgcgaccacgac
gacgccccctggcggcgcctgctaccgccggccctggtgatccgggcgggttgggccccg
acggtgaacgtgcacgtccgcgacggggccgcagtggacgtctggatcgagttggagggc
ggcgggtaccgctcgagcctggtgcaggaggagaactgggcgccggcccggcaggtcggg
gaccggtggaccgggcaggccaccttccgcatccccggggacctgccgctgggctaccac
cggctcaaggcctggtccgagggtgacgaggcgtcgtgtgcgctgatcgtcacgccgcag
cgggtgggcctgccggagcggctcggcgaccggcgcgcctgggggatcgccacccagctc
tacagcgtccgctcggccggctcctggggcgtcggcgacgtggtcgacctggaggacctg
tccgtctggggggcggacctgggcgccgggtacgtgctgatcaacccgctgcacgcggcc
gaaccgtccggccggatggaaccctccccgtacctgccgaccacccgccgcttccagaac
cccatctacctgcgggtcgagcgcatccccgagtacgccgacctgccggccgccgaccgg
gccgaggtcggctcgctcaaggcggcgttgcagcaggacctggcggggctggacgcgatc
gaccgggacaccacctggacggccaaggccgcggccctgcgcctggtgcacgcggtgccc
cggtcggccggccgggagctggcctacgccgcctaccgggaacgggagggcgagggcctg
gacaactacgcgacctggtgtgccctgaccgaccggcacggcaaggactggcacgagtgg
ccggacgagctgcagcatccggccaccccggaggtgctcgccttccgggccgaacacgcc
gacgacgtcgacttctaccgctggctgcagttcgtgctcgacgagcagctgtccatcgcc
caggcggcgacccggcggtcggggatggccctgggcgtcatgcacgacctggccgtgggc
gtgcacccggagggctcggactcctggagcctgcaggacgtcttcgcccagggcatcacc
gtcggcgccccgccggacgcgttcaaccaggccgggcaggactgggcgcaaccgccgtgg
cgtccggaccggctggccgagcaggggtacgccccgttccgggacatggtccgcacggtg
ctgcgggccgccggcggggtccgggtcgaccacatcatcgggctgttccggctctggtgg
atcccggacggcatgggccccaccgaggggacctacgtgcggtacgaccacgaggcgctg
atcggcatcctggccctggaggcgtcccggtcgggcgcgatcgtcgtcggcgaggacctg
ggcacggtcgagccgtgggtgcgcgagtacctgtcggaacggggcatcctgggcacctcg
atcctgtggttcgagttcgagttcgacggggacggccggccgctgcggcccgagcgctgg
cgggagtactgcctggcctcggtgaccacccacgacctgccaccgaccgccgggtacctg
gccggcgaccacgtccggctgcgcgacgagctgggcctgctgacccggtcgctggaggag
gaactggccgccgacgacgccgaacgcgccgcctggatcgaggagctgcggcaacggggc
gcgctgaccgcggcgacggcctcctcggccaccggcaagctcgatccggactcgcccgac
ctggccggactggagctggagagcaccgtgcaggccctgcaccggtacctgacctggacc
ccgtccaagctgctgtgtgtggccctgaccgacatggtcggcgatcgccgcacccagaac
cagccgggcaccatcgacgagtacccgaactggcgggtgccgttgaccggtcccgacggg
gcgccgatgagcctggagcaggtgttcgtctccagccgggcccgccggttggcccaggtg
gtcaacgagagctga

DBGET integrated database retrieval system