KEGG   Nakamurella multipartita: Namu_4931Help
Entry
Namu_4931         CDS       T00991                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nml  Nakamurella multipartita
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Namu_4931
   01230 Biosynthesis of amino acids
    Namu_4931
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_4931
  Energy metabolism
   00680 Methane metabolism
    Namu_4931
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Namu_4931
Enzymes [BR:nml01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Namu_4931
Exosome [BR:nml04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Namu_4931
  Exosomal proteins of melanoma cells
   Namu_4931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5505311..5506054)
Genome map
AA seq 247 aa AA seqDB search
MTYTLILLRHGESTWNALNQFTGWVDVPLSEKGTAEAIRGGGLIADAGVLPDVLHTSLLR
RAIMTANLALDAADRHWIPVRRSWRLNERHYGDLQGKNKKQTLDTYGEEQFMLWRRSYDT
PPPPISDTNEFSQAGDPRYADLGDDAPKTECLADVVARMESYLYGPIFDDLKEGKTVLVA
AHGNSLRAVVKMLDEISDEGIAKVNLPTGIPLKYELDENFKPIKAGGEYLDPEAAAAAIT
AVANQGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacatacaccttgatcctgttgcgccacggcgaaagcacctggaacgcgttgaaccag
ttcaccgggtgggtcgacgtcccgctgtccgagaagggcacggccgaggcgatccggggc
ggcggcctgatcgccgacgccggggtcctgcccgacgtgctgcacacctcgctgctgcgc
cgggccatcatgacggccaacctggcgctggacgcggccgaccggcactggatcccggtg
cggcggtcctggcggctcaacgagcgtcattacggcgacctgcagggcaagaacaagaag
cagacgctggatacctacggcgaggagcagttcatgctctggcggcggtcctacgacacc
ccgccgccgcccatcagcgacaccaacgagttctcccaggccggggacccccgttacgcc
gatctcggcgacgacgccccgaagaccgaatgcctggccgacgtcgtcgcccggatggag
tcctacctgtacgggccgatcttcgacgacctgaaggaaggcaagaccgtgctggtcgcg
gcgcacggcaactccctgcgggccgtggtcaagatgctggacgagatcagcgacgagggc
attgccaaggtgaacctgcccaccggcatcccgctgaagtacgaactggacgagaacttc
aagccgatcaaggccggcggcgagtacctggatccggaggcggcggccgcggccatcacc
gcggtggccaaccagggccgctga

DBGET integrated database retrieval system