KEGG   Nakamurella multipartita: Namu_4931Help
Entry
Namu_4931         CDS       T00991                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nml  Nakamurella multipartita
Pathway
nml00010  Glycolysis / Gluconeogenesis
nml00260  Glycine, serine and threonine metabolism
nml00680  Methane metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01200  Carbon metabolism
nml01230  Biosynthesis of amino acids
Module
nml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nml_M00002  Glycolysis, core module involving three-carbon compounds
nml_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_4931
  Energy metabolism
   00680 Methane metabolism
    Namu_4931
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Namu_4931
Enzymes [BR:nml01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Namu_4931
Membrane trafficking [BR:nml04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Namu_4931
Exosome [BR:nml04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Namu_4931
  Exosomal proteins of melanoma cells
   Namu_4931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACV81205
UniProt: C8XA05
Position
complement(5505311..5506054)
Genome map
AA seq 247 aa AA seqDB search
MTYTLILLRHGESTWNALNQFTGWVDVPLSEKGTAEAIRGGGLIADAGVLPDVLHTSLLR
RAIMTANLALDAADRHWIPVRRSWRLNERHYGDLQGKNKKQTLDTYGEEQFMLWRRSYDT
PPPPISDTNEFSQAGDPRYADLGDDAPKTECLADVVARMESYLYGPIFDDLKEGKTVLVA
AHGNSLRAVVKMLDEISDEGIAKVNLPTGIPLKYELDENFKPIKAGGEYLDPEAAAAAIT
AVANQGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacatacaccttgatcctgttgcgccacggcgaaagcacctggaacgcgttgaaccag
ttcaccgggtgggtcgacgtcccgctgtccgagaagggcacggccgaggcgatccggggc
ggcggcctgatcgccgacgccggggtcctgcccgacgtgctgcacacctcgctgctgcgc
cgggccatcatgacggccaacctggcgctggacgcggccgaccggcactggatcccggtg
cggcggtcctggcggctcaacgagcgtcattacggcgacctgcagggcaagaacaagaag
cagacgctggatacctacggcgaggagcagttcatgctctggcggcggtcctacgacacc
ccgccgccgcccatcagcgacaccaacgagttctcccaggccggggacccccgttacgcc
gatctcggcgacgacgccccgaagaccgaatgcctggccgacgtcgtcgcccggatggag
tcctacctgtacgggccgatcttcgacgacctgaaggaaggcaagaccgtgctggtcgcg
gcgcacggcaactccctgcgggccgtggtcaagatgctggacgagatcagcgacgagggc
attgccaaggtgaacctgcccaccggcatcccgctgaagtacgaactggacgagaacttc
aagccgatcaaggccggcggcgagtacctggatccggaggcggcggccgcggccatcacc
gcggtggccaaccagggccgctga

DBGET integrated database retrieval system