KEGG   Nakamurella multipartita: Namu_5309Help
Entry
Namu_5309         CDS       T00991                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nml  Nakamurella multipartita
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:nml01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nml00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nml00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nml00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5935722..5937197)
Genome map
AA seq 491 aa AA seqDB search
MTSTESTTRPTGRLETFRMPDAGEGLTEADIIGWRVAVGDTVTVNQVIVEIETAKAAVEL
PCPYAGRVHQLLAEPGATVEVGTPIITIDTGTDTGTAPAGDHGAVVEGGPVNGAAAETGS
KIGEVTADGRIATLVGYVPAGRSGGRRARRAAPTGAAAPASRAPAAPVSSPPPVPAEPEP
PAAHATHAAPLATPPVRKLAKDLGIDLHAVAPSRADGVISREDVEHAAAARTRPAAGPDR
EPAPPAARASTRPDDGSREYRIAVTGVRKATAAAMVASAFTAPHVTEFLTVDVTPMMQLR
ERLRTRREFADAPPTPLALTARAVCLAARRTPEINSVYEAGTDGPDQILVKRDVHLGIAA
ATDRGLIVPVIRDADAMGLADLARALQELTATARAGRTSLAQLTGGTFTITNVGVFGVDT
GTPIINPGQSAILALGAIRDAPWVVDGELAVRKVCQLALSFDHRVIDGQQGSQFLADIGA
LLADPGLALAF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcaccgagagcaccacccgaccgaccggccggctcgagaccttccgcatgccg
gacgccggcgaaggcctgaccgaggccgacatcatcggctggcgggtcgccgtcggcgac
accgtcaccgtcaaccaggtcatcgtggagatcgagacggccaaggcggccgtcgaactg
ccctgcccgtacgccggccgggtccaccagctgctcgccgaaccgggcgcgaccgtcgag
gtcgggacgccgatcatcaccatcgacaccggaaccgacaccgggaccgctccggcgggt
gaccacggcgccgtcgtcgagggtggcccggtcaacggcgccgcggccgagaccgggtcc
aagatcggtgaggtgaccgccgacgggcggatcgccacgctggtcggctacgtgccggcc
ggacggtcggggggccgccgcgcccgccgcgccgccccgaccggggcggccgcccccgca
tcacgcgccccggccgcccctgtgtcatcgccgccgccggtcccggccgagccggaaccg
ccggccgcgcacgcgacccacgcggctccgctggccactccgccggtccgcaagctggcc
aaggatctgggtatcgacctgcacgcggtggccccctcccgcgcggacggggtgatcagc
cgggaggacgtcgagcacgccgccgcggcgcggacccggccggccgcgggtccggatcgg
gagccggctccgccggcggcccgcgcgtcgaccaggcccgacgacgggtctcgggagtac
cggatcgcggtgaccggggtgcgcaaggcgaccgccgcggccatggtggccagcgcgttc
accgccccgcacgtgaccgagttcctcaccgttgacgtcaccccgatgatgcagctgcgg
gagcggctgcggacccgccgggaattcgccgacgcgcccccgacgccgctggccctgacc
gcccgcgccgtgtgcctggccgcccggcgcacccccgagatcaattcggtctacgaggcg
ggcaccgacggcccggaccagatcctggtcaagcgggacgtgcacctgggcatcgccgcg
gccaccgaccgcgggctgatcgtgccggtcatccgggacgcggacgcgatgggcctggcc
gacctggcccgggccctgcaggagctcaccgccaccgcccgggccggtcggaccagcctg
gcccagctgaccggcggcaccttcaccatcaccaacgtgggggtgttcggggtggacacc
ggcacgccgatcatcaacccgggccagtcggcgatcctggccctgggcgcgatccgggac
gcgccgtgggtcgtcgacggtgagttggcggtgcgcaaggtatgccagctggcgctcagc
ttcgaccaccgcgtcatcgacgggcagcagggctcgcagttcctggccgacatcggtgcc
ctgctggccgatccggggctggccctggccttctga

DBGET integrated database retrieval system