KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0303Help
Entry
NMBM01240149_0303 CDS       T01930                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:nmm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:nmm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nmm00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:nmm00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:nmm00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(331410..332183)
Genome map
AA seq 257 aa AA seqDB search
MYHQIGMWDQKWVIGNWKMNGRLQNNNSLMHRFRILPTAERVLIGLAAPTVYLLQLHNAM
QIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQR
RKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGT
GKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGA
SLSYDSFTAIISAAQNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaccaaatcggaatgtgggatcaaaaatgggtcatcggcaactggaaaatgaac
ggccggctccagaacaacaattcgctcatgcaccgcttccgcatcctccccaccgccgaa
cgcgtcctcatcggactcgccgccccgaccgtttacctgctgcaactgcacaacgccatg
caaatcgtcttaaacaaccgcatcctcacctgcgcccaagacgtgagccgcttccccgac
aacggcgcgtacaccggcgaagtgtccgccgaaatgctcgccgacaccggcacagacatc
gtcctcatcggacactccgaacgcagcctttatttcggcgaaaaaaacgaaatccaacgc
cgcaaaatggaaaacgtcctcaacgtcggactcatcccgttattgtgcgtcggcgaaagc
ctcgaagagcgcgaagccggcaaagaacacgaagtcatcgcccatcagctttctatcctc
caaggactggacaccaaaaacatcgccgtcgcctacgaacccgtctgggcgatcggcaca
ggcaaagtcgccaccgtcgaacagattgccgatatgcacgcattcatctacaaagaaatc
ttgtctttgtgcggaagcgatgttaaaatccgcgtcctttacggcggaagtgtgaaagcg
gacaacgcggccgacatcttcgcagtaccttatgtggacggcgcactcgtcggcggcgcg
tcattgtcgtacgactcctttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system