KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0492Help
Entry
NMBM01240149_0492 CDS       T01930                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nmm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
559775..560626
Genome map
AA seq 283 aa AA seqDB search
MARHGWQAGRFEIGLDKPKIMGIVNLTPDSFSDGGAYSQNAKTALAHAERLLKEGADILD
IGGESTRPGADYVSSEEEWARVEPVLVEVAGWGVPVSLDTRRTVVMEKALALGGIDIIND
VAALTDEGAVELLARQTDTGICLMHMQGLPETMQINPKYQDVVGEVARYLKARAAECIAA
GIAPQRITLDPGFGFGKTLQHNIALMRHLPELMAETGFPLLIGVSRKRMIGELTGEADAA
ARVHGSVAAAVAAVARGAQIVRVHDVKATADALKVWEALGINL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcacgacacggttggcaggcaggacggtttgaaatcggtttggacaagccgaaaatt
atgggcatcgtgaatctcacgcctgattctttttccgacggcggcgcgtattcgcaaaat
gccaaaaccgctttggcgcacgccgaacggcttttgaaagagggtgcggacattctcgac
attggcggcgaatcgacgcggccgggtgcggattatgtttcgtccgaagaagaatgggcg
cgggttgagcctgtattggtagaagtcgcgggatggggcgttcccgtcagtttggacacg
cgccgcacggtggttatggaaaaagcgttggcactcggcggcatcgatattattaacgat
gtggcggcgttgaccgacgaaggcgcggtcgaattgctggcgcgccagacggacacgggt
atttgcctgatgcatatgcagggtttgcctgaaaccatgcagattaatccgaaatatcag
gatgttgttggtgaagtggcgcggtatttgaaagcgcgggcggcggaatgcatcgcggca
ggcatcgccccgcaacgcatcacactcgaccccggtttcggtttcggcaaaaccttacaa
cacaatatcgcactgatgcggcatttacccgaattgatggcggaaacgggttttccgctg
ctcatcggcgtgtcgcgcaaacgtatgataggcgagctgactggcgaggcagacgcggcg
gcgcgcgtacacggcagcgtggcggcggctgtggcggctgtggcgcgcggcgcgcaaatt
gtgcgggtgcatgacgtgaaggcgacggcggacgcgttgaaggtgtgggaagcgttgggc
atcaatctgtaa

DBGET integrated database retrieval system