KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0765Help
Entry
NMBM01240149_0765 CDS       T01930                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMBM01240149_0765 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM01240149_0765 (glk)
   00052 Galactose metabolism
    NMBM01240149_0765 (glk)
   00500 Starch and sucrose metabolism
    NMBM01240149_0765 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NMBM01240149_0765 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBM01240149_0765 (glk)
   00524 Butirosin and neomycin biosynthesis
    NMBM01240149_0765 (glk)
Enzymes [BR:nmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NMBM01240149_0765 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
890432..891418
Genome map
AA seq 328 aa AA seqDB search
MSSTPNKQAGYPRLVADIGGTNARFALETAPRVIEKAAVLPCKDYDTVTDAVRAYLNQSG
ATAVRHAAFAIANPILGDWVQMTNHHWAFSIETTRQTLGLDTLILLNDFTAQALAVTQTS
SKDLMQVGGQKPVEFAPKAVIGPGTGLGVSGLVHSHAGWVALAGEGGHTSFPPFDDMEVL
IWQYAKNKYGHVSAERFLSGAGLSLVYEALAAKQKAKPAKLMPSEITEKALSGASPLCRQ
TLDIFCAMLGTVASNLALTLGARGGVYLCGGIIPRVLEYFKTSPFRSRFENKGRFEAYLA
AIPVYVVLSEFPGISGAAAALDNHLRNV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctacgccgaataaacaagccggatatccccgactggtcgccgatatcggcggg
acgaatgcacgctttgcgctggaaaccgcgccgcgcgtcattgaaaaagccgccgtgctt
ccgtgtaaagactacgatacggttaccgatgcggtgcgtgcctatctgaatcaaagcggt
gcaacagccgtacggcacgcggcatttgccatcgccaacccgattttgggcgactgggtg
cagatgaccaaccaccattgggcgttttccatcgaaaccacccgtcagactttggggctg
gacaccctcatccttttgaacgactttaccgcgcaggcattggcggtaacgcagacttca
agcaaagacctgatgcaggtaggcgggcaaaagcctgtcgaatttgcccccaaagccgtt
atcggccccggtaccggcctgggcgtgagcggattggtgcacagccacgcaggctgggtg
gctttggcgggcgagggcgggcataccagtttcccgccgtttgacgatatggaagtgctg
atttggcagtacgccaaaaacaaatacggccatgtttccgccgaacgctttttgagcggc
gcgggcttgagcttggtttacgaggctttggctgcaaaacagaaagccaaacccgccaaa
ctgatgccgtctgaaatcacggaaaaggctttgagcggcgcgtcgcctttgtgccgtcag
actttggacatcttctgcgccatgctcggcacggttgcttccaacctcgccctgacgctg
ggcgcgcgcggcggcgtgtacctgtgcggcggcattattccccgcgtgttggaatatttc
aaaacttccccgttccgcagccgtttcgagaacaagggcaggtttgaagcatatcttgcc
gcgattcccgtgtatgtcgtcttgagcgagtttcccggaatttccggtgcggctgcggct
ctcgacaaccatttgagaaacgtttaa

DBGET integrated database retrieval system