KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0911Help
Entry
NMBM01240149_0911 CDS       T01930                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMBM01240149_0911 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMBM01240149_0911 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMBM01240149_0911 (thrC)
Enzymes [BR:nmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NMBM01240149_0911 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1065632..1067041)
Genome map
AA seq 469 aa AA seqDB search
MKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRETLDKWRGSAYPELAFEIMR
LFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKIQALSNGPTLAFKDMAMQFL
GNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNVFMLSPDGKMSAFQRAQMYS
LQDGNIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVNSINWGRIVAQVVYYFAGYF
KATQSNDEQVSFCVPSGNFGNVCAGHIAKQMGLPIRRLIVATNENDVLDEFFKTGAYRPR
NSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTLWAEVAAGKGFDLRFALEKVGG
KYGFTSGKSTHPDRLATIRQVYEQDQELIDPHTADGVKVAREVREEGETVVCLETALAAK
FDATIREAVGDAAIPRPAALEGLETLPQRVQTVPNSADAVKGIIEQTLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattg
atggggcttgcccccgacggcggtctgatgctgccggaacattatccgcaaatcgggcgc
gaaaccttggacaaatggcgcggttcggcttatcccgaattggcgtttgaaattatgcgc
ctgttcgttacggatattccggaggacgatttgcgcgatattctgaaccgtacttacacg
gaagcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaa
atccaagccttgtccaacggcccgacgctggcgttcaaagatatggcgatgcagtttttg
ggcaatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgca
accagcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaaaggcgtgaac
gtatttatgttgtcgcccgacggtaagatgagcgcgttccaacgcgcgcagatgtacagc
ctgcaagacgggaatatccacaatatcgccgtgaagggtatgtttgacgactgtcaggat
attgtgaaggcggtgcagaacgatgccgcgttcaaggaaaaataccacatcggtacggtc
aattcgatcaactggggacgcatcgtcgcacaagtggtttattactttgcgggctatttc
aaagcgacacaaagcaatgacgagcaagtcagcttctgcgtgccgagcggcaacttcggc
aacgtttgcgcgggacacatcgccaaacagatgggtttgcctatccgccgcctgattgtc
gcgaccaatgaaaacgatgtgttggacgagtttttcaaaaccggtgcataccgcccgcgc
aacagcgcgcatacttatgttacctccagcccgtcgatggacatttccaaagcgtccaac
ttcgagcgtttcgtgttcgacctgatggatcgcgatcctcaggaaatcaatacgctgtgg
gcggaagtagcggcgggcaaaggctttgacctgcggtttgctttagaaaaagtcggtggc
aaatacggttttacctccggcaaatccacccaccccgaccgcctcgccaccatcagacag
gtttatgagcaagaccaagaactcatcgacccgcacactgccgacggcgtaaaagtcgcc
cgcgaagtgcgcgaagaaggggaaacggttgtgtgtttggaaaccgcgttggcagcgaaa
ttcgatgcgaccatacgcgaagccgtcggcgatgccgccattccgcgccccgccgcgctg
gaaggtttggaaacattgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggta
aaaggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system