KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_0941Help
Entry
NMBM01240149_0941 CDS       T01930                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nmm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1097015..1098760
Genome map
AA seq 581 aa AA seqDB search
MERQTDEFAQAAARAAIWFLARYAGSGSEVLANCTERLFQALQNGHSFIRLSGGEADALS
ALAPVVGTSAAPLILEGRRLFLGRMWQLEYDLAAEIKRLAAAGTSAPDAAGARQNLAKWF
QGTGSEGQRDAAALALLQSFMVITGGPGTGKTTTVAKLLALICGEDENLPNIALAAPTGK
AAAHMARALHRAINGFDAPEAIRRHLLKLEGQTVHRLLKLRPPKMQAAFNPVYPLPLDVL
VIDEASMLDTALMLQLLKAVKTGARVILLGDENQLPSVGIGAVLSVLSHKTVLDGETHQR
LAGFLPEHGFSVSANPPVLAQNTAHLSFSHRFGDNSGIGCLARAAVSGDEGAWALFDRFP
DELEHSECSPNARVERLYRAHKAYWQAVKDGNIEAAYAGISDIVVLAAWRQDAEDFNEAY
CSHVRRKMNIPEHQAYFAGEPIMIRQNDYALELFNGDIGLIMEDVGRQGSLAAYFADADG
FKKVAVSCLPDFEPAFAMTVHKSQGSEYREVWLLPPSAAPSDEGDDALSGLSKELLYTAI
TRAREKFVFFGGEETFRQAAATVKTRQTALGSMLERVFSQE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggaacggcagacagatgaatttgcccaagcggcggcaagggcggcaatctggtttttg
gcacgctatgcgggttcaggcagcgaagtgcttgcaaactgcaccgaacgcctgtttcag
gcattgcaaaacggtcattcgtttatccgtttgagcggtggcgaggctgacgcgctgtcg
gcactcgcacccgtggtcggaacatccgccgcgcctttgattttggaaggcagaaggctg
tttttgggcaggatgtggcagttggaatacgatttggctgccgagataaaacgcttggcg
gcagccggcacgtccgcccccgacgcggcaggcgcgcggcaaaacctcgcaaaatggttt
caaggcacgggcagcgaagggcagcgcgatgccgccgccttggcactgttgcagtctttt
atggtgattaccggcgggccaggaacgggcaaaacgacaacggttgccaaactgctggcg
ctgatttgcggtgaagacgaaaatcttcccaacatcgcgcttgccgcaccgacaggcaaa
gcggcggcacatatggcgcgcgcgctgcaccgtgcaatcaacggttttgacgcgccggag
gccatccgccgccatttgctcaaactggaagggcaaaccgtccaccgactgctgaagctg
cgcccgcccaaaatgcaggcggcgttcaaccctgtttacccgctgccgttggacgtattg
gttatcgatgaagcctccatgttggataccgcattgatgttgcaacttttaaaagcggtc
aaaaccggcgcgcgcgtgattctgctgggggatgaaaaccagctcccgtccgtcggaatc
ggggcggtgctgtccgttttgtcgcacaaaaccgttttggacggagaaacgcaccaaagg
ctggccggcttccttccggaacacggtttcagcgtcagcgcaaatccgcccgtgttggcg
caaaacaccgcccatctgtcgttcagccaccgcttcggcgacaacagtggcatcggctgc
cttgcccgtgccgccgtatcgggcgatgagggggcgtgggcattgtttgaccggtttccg
gacgaactggaacattcggaatgcagtccgaacgctcgagtcgaaaggttgtaccgggcg
cacaaagcctattggcaggcggtaaaagacggcaatatcgaagccgcatacgcaggcatc
tcggatatcgtggtcctggcagcttggcggcaggatgcggaagacttcaacgaagcctat
tgcagccatgtacgccgcaaaatgaacataccggaacatcaggcctatttcgccggagaa
ccgattatgatcagacagaacgactacgcgcttgaactgttcaacggcgacatcggattg
attatggaagatgtcggacggcagggcagccttgccgcctattttgccgatgcggacgga
tttaaaaaggtagcggtaagctgcctgcccgatttcgaacccgcattcgccatgaccgtc
cacaaaagccaaggttcggaatatcgggaagtctggctgctgccgccttccgccgcacct
tcggacgaaggggacgatgcattgtccggattgagtaaggagctgttatataccgccatt
acccgcgcgagggagaagttcgtattcttcggcggagaagaaaccttccggcaagctgcc
gccactgtcaaaacgcgtcagacggcattgggcagtatgctcgagcgggtattttcacaa
gaataa

DBGET integrated database retrieval system