KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1130Help
Entry
NMBM01240149_1130 CDS       T01930                                 

Definition
succinate-CoA ligase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nmm01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nmm00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nmm00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:nmm00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1282339..1283505)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKELLASYGLPVQGGILAHNGEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAKEVAESLIGTNLVTYQTDANGQPVNSVLVCEDMYPVQTELYLGAVVDRSTR
RVTFMASTEGGVEIEKVAAETPEKIFKVTVDPLVGLQPCQAREVAFQLGLKDKQINEFVK
LMTGAYKAFVENDFALFEVNPLAVRENGALACVDGKIGIDSNALYRLPKIAELRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKDRVV
EAFKLILEDKSVKGVLINIFGGIVRCDMIAEAIVAAVKEINVDVPVVVRLEGNNAELGAK
ILNESGLKLTSADGLNDAAEKIVAAVNA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggctaaagaactgctggctagctacggtttgcccgtacaa
ggcggtattttggcacacaacggcgaagaagccgctgcagcttacgacaaattgggcggc
aaattcgctgttgtcaaagcacaagtacatgccggcggccgcggtaaagcgggcggcgta
aaagtcgttaaaagccgcgaagaagctaaagaagtggctgaaagcctgattggcaccaac
ttggtaacttaccaaaccgatgccaacggccaacctgtcaacagcgttttggtttgtgaa
gatatgtatccggttcaaaccgagctgtacttgggcgcagtggttgaccgttctacccgc
cgcgttacattcatggcttctaccgaaggtggcgtagaaatcgaaaaagttgctgccgaa
actccagaaaaaatcttcaaagtaaccgttgatccgctggtcggcctgcaaccttgccaa
gctcgcgaagttgccttccaactgggcttgaaagacaaacaaatcaacgagttcgtcaaa
ctgatgaccggcgcgtacaaagcgtttgtcgaaaacgacttcgccctgtttgaagtcaac
ccgctggcagttcgcgaaaacggcgcgctcgcctgcgtggacggcaaaatcggcatcgac
agcaacgcgctctaccgcctgccaaaaatcgctgaattgcgcgacaaatctcaagaaaac
gaacgtgaactgaaagcttctgaattcgacctgaactatgttgccctggaaggcaacatc
ggctgtatggttaacggtgccggtttggcgatggccaccatggacatcatcaaactcaaa
ggcggtcaacctgccaacttcttggacgttggcggcggcgcaaccaaagaccgcgtggtt
gaagcgttcaaactgattttggaagacaaatccgttaaaggcgtattgatcaacatcttc
ggcggtatcgtacgttgcgacatgattgcggaagccatcgtggcagccgttaaagaaatc
aacgtcgacgttcctgtcgttgttcgtttggaaggcaacaacgccgaactcggcgcgaaa
atcctgaacgaatcaggtctgaaactgacttctgcagacggcctgaatgacgcagccgaa
aaaattgttgcagccgtaaacgcctaa

DBGET integrated database retrieval system