KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1130Help
Entry
NMBM01240149_1130 CDS       T01930                                 

Definition
succinate-CoA ligase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMBM01240149_1130
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBM01240149_1130
   00640 Propanoate metabolism
    NMBM01240149_1130
   00660 C5-Branched dibasic acid metabolism
    NMBM01240149_1130
Enzymes [BR:nmm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NMBM01240149_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1282339..1283505)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKELLASYGLPVQGGILAHNGEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAKEVAESLIGTNLVTYQTDANGQPVNSVLVCEDMYPVQTELYLGAVVDRSTR
RVTFMASTEGGVEIEKVAAETPEKIFKVTVDPLVGLQPCQAREVAFQLGLKDKQINEFVK
LMTGAYKAFVENDFALFEVNPLAVRENGALACVDGKIGIDSNALYRLPKIAELRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKDRVV
EAFKLILEDKSVKGVLINIFGGIVRCDMIAEAIVAAVKEINVDVPVVVRLEGNNAELGAK
ILNESGLKLTSADGLNDAAEKIVAAVNA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggctaaagaactgctggctagctacggtttgcccgtacaa
ggcggtattttggcacacaacggcgaagaagccgctgcagcttacgacaaattgggcggc
aaattcgctgttgtcaaagcacaagtacatgccggcggccgcggtaaagcgggcggcgta
aaagtcgttaaaagccgcgaagaagctaaagaagtggctgaaagcctgattggcaccaac
ttggtaacttaccaaaccgatgccaacggccaacctgtcaacagcgttttggtttgtgaa
gatatgtatccggttcaaaccgagctgtacttgggcgcagtggttgaccgttctacccgc
cgcgttacattcatggcttctaccgaaggtggcgtagaaatcgaaaaagttgctgccgaa
actccagaaaaaatcttcaaagtaaccgttgatccgctggtcggcctgcaaccttgccaa
gctcgcgaagttgccttccaactgggcttgaaagacaaacaaatcaacgagttcgtcaaa
ctgatgaccggcgcgtacaaagcgtttgtcgaaaacgacttcgccctgtttgaagtcaac
ccgctggcagttcgcgaaaacggcgcgctcgcctgcgtggacggcaaaatcggcatcgac
agcaacgcgctctaccgcctgccaaaaatcgctgaattgcgcgacaaatctcaagaaaac
gaacgtgaactgaaagcttctgaattcgacctgaactatgttgccctggaaggcaacatc
ggctgtatggttaacggtgccggtttggcgatggccaccatggacatcatcaaactcaaa
ggcggtcaacctgccaacttcttggacgttggcggcggcgcaaccaaagaccgcgtggtt
gaagcgttcaaactgattttggaagacaaatccgttaaaggcgtattgatcaacatcttc
ggcggtatcgtacgttgcgacatgattgcggaagccatcgtggcagccgttaaagaaatc
aacgtcgacgttcctgtcgttgttcgtttggaaggcaacaacgccgaactcggcgcgaaa
atcctgaacgaatcaggtctgaaactgacttctgcagacggcctgaatgacgcagccgaa
aaaattgttgcagccgtaaacgcctaa

DBGET integrated database retrieval system