KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1130Help
Entry
NMBM01240149_1130 CDS       T01930                                 

Definition
(GenBank) succinate-CoA ligase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00020  Citrate cycle (TCA cycle)
nmm00640  Propanoate metabolism
nmm00660  C5-Branched dibasic acid metabolism
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01120  Microbial metabolism in diverse environments
nmm01130  Biosynthesis of antibiotics
nmm01200  Carbon metabolism
Module
nmm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBM01240149_1130
   00640 Propanoate metabolism
    NMBM01240149_1130
   00660 C5-Branched dibasic acid metabolism
    NMBM01240149_1130
Enzymes [BR:nmm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NMBM01240149_1130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADY97708
Position
complement(1282339..1283505)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKELLASYGLPVQGGILAHNGEEAAAAYDKLGGKFAVVKAQVHAGGRGKAGGV
KVVKSREEAKEVAESLIGTNLVTYQTDANGQPVNSVLVCEDMYPVQTELYLGAVVDRSTR
RVTFMASTEGGVEIEKVAAETPEKIFKVTVDPLVGLQPCQAREVAFQLGLKDKQINEFVK
LMTGAYKAFVENDFALFEVNPLAVRENGALACVDGKIGIDSNALYRLPKIAELRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLKGGQPANFLDVGGGATKDRVV
EAFKLILEDKSVKGVLINIFGGIVRCDMIAEAIVAAVKEINVDVPVVVRLEGNNAELGAK
ILNESGLKLTSADGLNDAAEKIVAAVNA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgagtatcaggctaaagaactgctggctagctacggtttgcccgtacaa
ggcggtattttggcacacaacggcgaagaagccgctgcagcttacgacaaattgggcggc
aaattcgctgttgtcaaagcacaagtacatgccggcggccgcggtaaagcgggcggcgta
aaagtcgttaaaagccgcgaagaagctaaagaagtggctgaaagcctgattggcaccaac
ttggtaacttaccaaaccgatgccaacggccaacctgtcaacagcgttttggtttgtgaa
gatatgtatccggttcaaaccgagctgtacttgggcgcagtggttgaccgttctacccgc
cgcgttacattcatggcttctaccgaaggtggcgtagaaatcgaaaaagttgctgccgaa
actccagaaaaaatcttcaaagtaaccgttgatccgctggtcggcctgcaaccttgccaa
gctcgcgaagttgccttccaactgggcttgaaagacaaacaaatcaacgagttcgtcaaa
ctgatgaccggcgcgtacaaagcgtttgtcgaaaacgacttcgccctgtttgaagtcaac
ccgctggcagttcgcgaaaacggcgcgctcgcctgcgtggacggcaaaatcggcatcgac
agcaacgcgctctaccgcctgccaaaaatcgctgaattgcgcgacaaatctcaagaaaac
gaacgtgaactgaaagcttctgaattcgacctgaactatgttgccctggaaggcaacatc
ggctgtatggttaacggtgccggtttggcgatggccaccatggacatcatcaaactcaaa
ggcggtcaacctgccaacttcttggacgttggcggcggcgcaaccaaagaccgcgtggtt
gaagcgttcaaactgattttggaagacaaatccgttaaaggcgtattgatcaacatcttc
ggcggtatcgtacgttgcgacatgattgcggaagccatcgtggcagccgttaaagaaatc
aacgtcgacgttcctgtcgttgttcgtttggaaggcaacaacgccgaactcggcgcgaaa
atcctgaacgaatcaggtctgaaactgacttctgcagacggcctgaatgacgcagccgaa
aaaattgttgcagccgtaaacgcctaa

DBGET integrated database retrieval system