KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1133Help
Entry
NMBM01240149_1133 CDS       T01930                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase succinyl-transferring complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
nmm00020  Citrate cycle (TCA cycle)
nmm00310  Lysine degradation
nmm01100  Metabolic pathways
nmm01110  Biosynthesis of secondary metabolites
nmm01120  Microbial metabolism in diverse environments
nmm01130  Biosynthesis of antibiotics
nmm01200  Carbon metabolism
Module
nmm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBM01240149_1133 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    NMBM01240149_1133 (sucB)
Enzymes [BR:nmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMBM01240149_1133 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADY97711
Position
complement(1285813..1286979)
Genome map
AA seq 388 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPVAAPAEAAPAAAPAAAQNNAAMPAAAKLAAETG
VDVNALQGSGRDGRVLKEDVQNAAAKPAAAAAPAGARPEERVPMSRLRARVAERLLASQQ
ENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKKYPVVNASVD
GKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIAIEDLT
GGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLALSYDHR
IIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtcccttccccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgcatcgatacagctgct
actgccgctgccgaagcacccgtagccgctcctgccgaagccgccccggctgccgctcct
gctgccgcacaaaacaacgccgctatgcctgccgccgccaaactggctgcggagaccggt
gttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccgcagccgcagcccctgccggcgcacgtcctgaagaa
cgcgtaccaatgagccgcctgcgtgcccgtgttgcagaacgcctcttggcttctcaacaa
gaaaacgccattctgactacattcaacgaagtcaacatgaaaccaatcatggacttgcgt
gcgaagtacaaagaaaaattcgagaaagaacacggcgtgaaattgggctttatgtccttc
ttcgttaaagccgctgtcgccgccctgaaaaaatacccggttgtgaatgcttctgttgac
ggcaaagacatcgtgtaccacggctacttcgacatcggtatcgcgattggcagcccacgc
ggtttggttgtgccaatcctgcgcgatgccgaccaaatgagcattgccgacatcgaacaa
gcaattgttgattacgcgaaaaaagccaaagatggcaaaatcgctatcgaagatctgacc
ggcggtacattcagtattaccaacggcggtactttcggttctatgatgtctaccccgatc
atcaacccgcctcaatctgcgattttgggtatgcatgccactaaagagcgcgctgtggtt
gaaaacggtcaagttgttgtccgtccaatgatgtatctggctctgtcttacgaccaccgt
atcatcgacggtcgcgaagctgtattgactttggtagccattaaagacgcgttggaagac
ccagcccgcctgttgttggatctgtaa

DBGET integrated database retrieval system