KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1299Help
Entry
NMBM01240149_1299 CDS       T01930                                 

Definition
phosphoglucomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM01240149_1299
   00030 Pentose phosphate pathway
    NMBM01240149_1299
   00051 Fructose and mannose metabolism
    NMBM01240149_1299
   00052 Galactose metabolism
    NMBM01240149_1299
   00500 Starch and sucrose metabolism
    NMBM01240149_1299
   00520 Amino sugar and nucleotide sugar metabolism
    NMBM01240149_1299
  Nucleotide metabolism
   00230 Purine metabolism
    NMBM01240149_1299
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBM01240149_1299
Enzymes [BR:nmm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NMBM01240149_1299
    5.4.2.8  phosphomannomutase
     NMBM01240149_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1437933..1439315
Genome map
AA seq 460 aa AA seqDB search
MANIARDIFKAYDIRGIVGKTLTDDAAYLIGRAIAAKAAEKGMTRIALGRDGRLSGPELM
EHIQRGFTDSGIDVLNVGMVATPMLYFAAINECGGSGVMITGSHNPPDYNGFKMMLGGDT
LAGEAIQELLAIIEKDGFVAADKQGNVTEKDISGEYHNHIVGHIKLKRPMNIAIDAGNGV
GGAFAGKLYKGLGNEVTELFCDVDGNFPNHHPDPSKPKNLQDLIAALKNGDAEIGLAFDG
DADRLGVVTKDGNIIYPDRQLMLFAQDVLSRNPKAKVIFDVKSTRLLAPWIKEHGGEPVM
EKTGHSFIKSSMKKTGAPVAGEMSGHIFFKERWFGFDDGLYAGARLLEILSASDNPSEVL
NNLPQSISTPELNIALPEGSNGHQVIDELAAKAEFEGATEIITIDGLRVEFPDGFGLMRA
SNTTPILVLRFEADTQEAIERIQNQFKAVIESNPNLIWPL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattgcccgcgacatcttcaaagcctacgacatccgaggcattgtcggcaaa
accctgaccgacgatgccgcctatctcatcggcagggccatcgccgccaaagccgccgaa
aaaggcatgacccgcatcgcgctcggacgcgacggacgcttgagcggtcccgaactgatg
gagcacatccaacgcggctttaccgacagcggcatcgacgtcctcaacgtcggtatggtc
gccacgcccatgctctattttgccgccatcaacgaatgcggcggcagcggcgtgatgatt
accggcagccacaatccgcccgattacaatggtttcaaaatgatgctcggcggcgacacg
ctcgcaggcgaagccattcaagaacttttagccattattgaaaaagacggttttgttgcc
gccgacaaacaaggcaacgtaaccgaaaaagacatctccggcgaataccacaaccacatc
gtcggccacatcaaactcaaacgcccgatgaacatcgctatcgacgcgggcaacggcgtg
ggcggcgcgtttgccggcaaactctataaaggcttgggcaacgaagtaaccgagcttttc
tgcgacgtggacggcaatttccccaaccaccatcccgacccatccaaacccaaaaacctg
caagatttgattgccgcgctgaaaaacggcgatgccgaaatcggcttggcgtttgacggc
gatgccgaccgcttgggcgtagttaccaaagacggcaacatcatctatccagaccgccaa
ctgatgcttttcgcgcaagacgtgttgagccgcaatcctaaagccaaagtaattttcgac
gtcaaatccacccgtctgcttgcgccttggattaaagaacacggcggcgaacctgtgatg
gaaaaaaccggccacagctttatcaaatcctccatgaaaaaaaccggcgcgccggttgcc
ggcgaaatgagcggacacatcttcttcaaagaacgctggttcggcttcgacgacggtctg
tacgccggcgcacgcctcttggaaatcctgtctgcctccgataatccgtccgaagtgtta
aacaacctgccgcaaagcatttccacgcccgaactcaacatcgccctgcccgaaggcagc
aacggccatcaggttatcgacgaactcgccgccaaagccgaatttgaaggcgcaaccgaa
atcatcaccatcgacggtctgcgcgttgaatttcccgacggcttcggtctgatgcgtgct
tccaataccacgccgattctggtgttgcgttttgaggcggatacgcaagaagccatcgag
cggattcaaaaccaattcaaagccgtcatcgaaagcaatccgaatctaatctggcctctg
taa

DBGET integrated database retrieval system