KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1311Help
Entry
NMBM01240149_1311 CDS       T01930                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMBM01240149_1311
Enzymes [BR:nmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NMBM01240149_1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1452980..1453720)
Genome map
AA seq 246 aa AA seqDB search
MLIVRPSGRAKDDVETCRRAGWQAEVLSPIEIEADAAGLELLSEQYARADAVFWVSPTAV
ETAVPYLNLSDGIKIHIAVGQGSRRALERYLGRTVIAPHDGNDSEAVLRLPVWNSLPEGA
RVLFVRGHGGRDFLMNALQEKGFRTEMAEVYFRRHKPLNFQNFQTENIAAAYITSTELVR
LLFGQLPPQFSRFFKSLLYFTHHPRIAEALKREGVCSVETVPTLEAALSHSSISVSDGMV
FPGTSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgtccgaccgtcgggcagggcgaaggacgatgtggaaacctgccgtcgtgcc
ggatggcaggcggaagtgttgagcccgattgaaatcgaagcagatgctgccggactggaa
cttttgtccgaacaatatgcccgtgcggatgccgtgttttgggtcagtccgaccgccgtt
gaaaccgccgtcccgtaccttaacctttcagacggcataaagatacacattgccgtaggg
cagggcagccgccgcgcattggaacgctatttgggcagaacggtcattgcgcctcatgac
ggaaacgacagcgaggcggttttgcgcctgccggtttggaacagtctgcccgaaggtgca
cgcgtattgtttgtgcgcggacacggcgggcgggattttctgatgaatgccttgcaggag
aaaggttttcggacggagatggcagaagtctatttcagacggcataaacctttgaacttt
caaaatttccaaaccgaaaatattgccgccgcctatattacgtcgaccgagctggtgcgc
ttgctgttcgggcagcttccgccgcaattttcccgattcttcaaatccttgctatacttt
acccatcatccgcgcattgcggaggcattgaagcgcgaaggcgtgtgttcggtcgaaacc
gtccctacgctggaagccgcgctttcccattcttccatttccgtttcagacggcatggtc
tttcccggaacctcaaattaa

DBGET integrated database retrieval system